Os03t0770800-01

Locus

Os03g0770800

Description

CSLC9.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLC9

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE C9

Oryzabase Gene Symbol Synonym(s)

OsCslC9, OsCSLC9

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK121805 (DDBJ, Best hit)

Protein Evidence

C8CBX4 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Glycosyl transferase, family 2 (IPR001173)

Full-length cDNA

J033097L05 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0770800-01)

RiceXPro (AK121805)

Others

Oryzabase (13896)

KEGG (Os03t0770800-01)

Transcript

2259 bp

>Os03t0770800-01 CSLC9.
GCTTCTTCTTGAGCTTAAATGGCAGTGGGATCAGCTGCGTAGGTGTGAGGGGGAGGGATT
GGCATTGAGGGGTGGGGGGAGGTGGAGGTCCAGGAATAGGGTGTGGGTGAAGTGTGGGAG
GCTAATTTGGGGGTGAGAGAGGAGAAGGAGAGGTGAGGGGTGgggggaggaggaggggga
ggctggttcttggaccggccattggatggcgccgtggagcggcttatggggcgggaagtt
ggccgccgccggcgagagccccgtgctccgctcccgcttctacgcgttcatcagggcatt
cgtcgtcctctcggtgctcctcctcatcgttgagctcggcgcctacatcaatggctggga
cgacctcgccgcctccgcgctcgccctccccgtcatcggcgtcgagtcgctctacgcgtc
gtggctgcgcttccgcgccacctatgtcgcgccattcatccagttcctcaccgacgcatg
cgtcgtgctcttcctcatccagagcgccgaccgcctcatccagtgcctcggctgcttcta
catccatctcaagcgcatcaagcctaaccccaagtcaccggcattgcccgacgccgaaga
ccccgacgccgcgtactaccccatggtactcgtgcagataccaatgtgcaacgagaagga
ggtttatcagcaatcaattgcggccgtgtgcaatcttgattggccgaggtccaacttctt
ggttcaggtattggatgattcggacgatccgacgacgcagacactgatcagagaagaggt
gctcaagtggcagcagaacggcgctcggattgtgtaccggcatcgtgtccttagggatgg
ttataaggctggaaatctcaagtcggcgatgagctgcagctatgtcaaggactatgagtt
tgttgccatctttgatgcggacttccaaccgaatccggacttcttgaagcgaaccgtgcc
acatttcaaggacaatgatgaattggggctagtgcaagcaagatggtcatttgtgaataa
ggatgagaacctattgactcgtctgcaaaacattaatctttgcttccactttgaggtaga
acagcaagtgaatgggatattcctaaacttcttcgggttcaatggcactgctggtgtgtg
gagaatcaaggcattggatgactcgggagggtggatggagcgtacaacagtggaggacat
ggacattgcagtccgggcacaccttaggggctggaaatttatcttcctgaatgacgtcga
gtgccaatgtgaattgccagagtcatacgaagcttataggaagcagcagcatcggtggca
ttctggtccaatgcagctattcagactctgcttaccagacattatcaaatgcaagattgt
gttttggaagaaagccaacttgatcttccttttcttccttctccggaagctcatactacc
attctactctttcacgctcttctgcatcatcctcccaatgacgatgtttgtgcctgaagc
cgagcttcctgactgggtcgtatgctacattcctgccctgatgtccttgctcaacatcct
gccttctccgaagtctttccctttcatcatcccatacctacttttcgagaacaccatgtc
cgtgacaaaattcaatgccatgatctctggtctgttccagcttggaaatgcatacgagtg
ggtggtgaccaagaagtcaggccgatcatcggagggcgacctcatttctttggcacccaa
agagttgaaacaccaaaaaactgaatcggcgcctaacctcgacgctattgcaaaggagca
gtccgctcctagaaaggacgtaaagaagaagcacaaccggatatacaagaaagagcttgc
actctcattgctcctcctaaccgctgcagctcgcagtttgctctcgaaacagggtataca
tttctacttcctcctgttccagggcatatctttcttgttagtaggccttgatctcatagg
cgagcaGATTGAGTAAACTGTGAAAAGCATGATAGATGTTAAAAAAACAGTGACAATGGA
GGGTGCTCCAGGGATGTTGTGTCGAAGCTCTTTGGCGATATTGAAATGTTGCATGACGCA
ATTGTGTCGTCCAATTGATTTATGTCACGACTTCACACAACATGATCCACAATGTACACG
CCCAAATAGGCCCCTCCCCCCTCGGTTGTGTAGATATAGTTGTTCTTGGACTGTAAATTT
GCCTAGTTATTCCAAGACTATCCGATTCTTTTGTAAACC

CDS

1791 bp

>Os03t0770800-01 CSLC9.
atggcgccgtggagcggcttatggggcgggaagttggccgccgccggcgagagccccgtg
ctccgctcccgcttctacgcgttcatcagggcattcgtcgtcctctcggtgctcctcctc
atcgttgagctcggcgcctacatcaatggctgggacgacctcgccgcctccgcgctcgcc
ctccccgtcatcggcgtcgagtcgctctacgcgtcgtggctgcgcttccgcgccacctat
gtcgcgccattcatccagttcctcaccgacgcatgcgtcgtgctcttcctcatccagagc
gccgaccgcctcatccagtgcctcggctgcttctacatccatctcaagcgcatcaagcct
aaccccaagtcaccggcattgcccgacgccgaagaccccgacgccgcgtactaccccatg
gtactcgtgcagataccaatgtgcaacgagaaggaggtttatcagcaatcaattgcggcc
gtgtgcaatcttgattggccgaggtccaacttcttggttcaggtattggatgattcggac
gatccgacgacgcagacactgatcagagaagaggtgctcaagtggcagcagaacggcgct
cggattgtgtaccggcatcgtgtccttagggatggttataaggctggaaatctcaagtcg
gcgatgagctgcagctatgtcaaggactatgagtttgttgccatctttgatgcggacttc
caaccgaatccggacttcttgaagcgaaccgtgccacatttcaaggacaatgatgaattg
gggctagtgcaagcaagatggtcatttgtgaataaggatgagaacctattgactcgtctg
caaaacattaatctttgcttccactttgaggtagaacagcaagtgaatgggatattccta
aacttcttcgggttcaatggcactgctggtgtgtggagaatcaaggcattggatgactcg
ggagggtggatggagcgtacaacagtggaggacatggacattgcagtccgggcacacctt
aggggctggaaatttatcttcctgaatgacgtcgagtgccaatgtgaattgccagagtca
tacgaagcttataggaagcagcagcatcggtggcattctggtccaatgcagctattcaga
ctctgcttaccagacattatcaaatgcaagattgtgttttggaagaaagccaacttgatc
ttccttttcttccttctccggaagctcatactaccattctactctttcacgctcttctgc
atcatcctcccaatgacgatgtttgtgcctgaagccgagcttcctgactgggtcgtatgc
tacattcctgccctgatgtccttgctcaacatcctgccttctccgaagtctttccctttc
atcatcccatacctacttttcgagaacaccatgtccgtgacaaaattcaatgccatgatc
tctggtctgttccagcttggaaatgcatacgagtgggtggtgaccaagaagtcaggccga
tcatcggagggcgacctcatttctttggcacccaaagagttgaaacaccaaaaaactgaa
tcggcgcctaacctcgacgctattgcaaaggagcagtccgctcctagaaaggacgtaaag
aagaagcacaaccggatatacaagaaagagcttgcactctcattgctcctcctaaccgct
gcagctcgcagtttgctctcgaaacagggtatacatttctacttcctcctgttccagggc
atatctttcttgttagtaggccttgatctcataggcgagcaGATTGAGTAA

Protein

597 aa

>Os03t0770800-01 CSLC9.
MAPWSGLWGGKLAAAGESPVLRSRFYAFIRAFVVLSVLLLIVELGAYINGWDDLAASALA
LPVIGVESLYASWLRFRATYVAPFIQFLTDACVVLFLIQSADRLIQCLGCFYIHLKRIKP
NPKSPALPDAEDPDAAYYPMVLVQIPMCNEKEVYQQSIAAVCNLDWPRSNFLVQVLDDSD
DPTTQTLIREEVLKWQQNGARIVYRHRVLRDGYKAGNLKSAMSCSYVKDYEFVAIFDADF
QPNPDFLKRTVPHFKDNDELGLVQARWSFVNKDENLLTRLQNINLCFHFEVEQQVNGIFL
NFFGFNGTAGVWRIKALDDSGGWMERTTVEDMDIAVRAHLRGWKFIFLNDVECQCELPES
YEAYRKQQHRWHSGPMQLFRLCLPDIIKCKIVFWKKANLIFLFFLLRKLILPFYSFTLFC
IILPMTMFVPEAELPDWVVCYIPALMSLLNILPSPKSFPFIIPYLLFENTMSVTKFNAMI
SGLFQLGNAYEWVVTKKSGRSSEGDLISLAPKELKHQKTESAPNLDAIAKEQSAPRKDVK
KKHNRIYKKELALSLLLLTAAARSLLSKQGIHFYFLLFQGISFLLVGLDLIGEQIE*

5'UTR

chr03:31934273..31934477 (- strand) : 205 bp

CDS

chr03:31934230..31934272 (- strand) : 43 bp

chr03:31933505..31933917 (- strand) : 413 bp

chr03:31933105..31933413 (- strand) : 309 bp

chr03:31932723..31933013 (- strand) : 291 bp

chr03:31932517..31932630 (- strand) : 114 bp

chr03:31931098..31931718 (- strand) : 621 bp

3'UTR

chr03:31930835..31931097 (- strand) : 263 bp

FASTA

>Os03t0770800-01 class=Sequence position=chr03:31930835..31934477 (- strand)
GCTTCTTCTT GAGCTTAAAT GGCAGTGGGA TCAGCTGCGT AGGTGTGAGG GGGAGGGATT GGCATTGAGG GGTGGGGGGA
GGTGGAGGTC CAGGAATAGG GTGTGGGTGA AGTGTGGGAG GCTAATTTGG GGGTGAGAGA GGAGAAGGAG AGGTGAGGGG
TGgggggagg aggaggggga ggctggttct tggaccggcc attggatggc gccgtggagc ggcttatggg gcgggaagtt
ggccgccggc ggcggcggcg gcggcggcga ccactaccgg ggcacgccgg tggtggtcaa gatggagaac cccaactggt
ccatctccga gatctcctcg ccggatgacg acgacgacga ggagttcttg gtcggcggcc gccgcaaggg ggggcgcggc
aagaacgcca agcagatcac ctgggtgctg ctgctcaagg cgcaccgcgc cgccgggtgc ctcgcgtcgc tggcctccgc
ggccgtcgcg ctcggcgccg ccgccaggcg gagggtcgcc gccgggagga cggacgccga cgcctccgcc gccgccgccg
ccggcgagag ccccgtgctc cgctcccgct tctacgcgtt catcagggca ttcgtcgtcc tctcggtgct cctcctcatc
gttgagctcg gcgcctacat caatggctgg gacgacctcg ccgcctccgc gctcgccctc cccgtcatcg gcgtcgagtc
gctctacgcg tcgtggctgc gcttccgcgc cacctatgtc gcgccattca tccagttcct caccgacgca tgcgtcgtgc
tcttcctcat ccagagcgcc gaccgcctca tccagtgcct cggctgcttc tacatccatc tcaagcgcat caagcctaac
cccaagtcac cggcattgcc cgacgccgaa gaccccgacg ccgcgtacta ccccatggta ctcgtgcaga taccaatgtg
caacgagaag gaggtTGGTT TGTGCTGTTG CTATCGCTCT AAAACATGCC ATTTTTTGTC TCCGAAGTAG CAACCTTTTG
ATGTTTGTTT GTTGGTCTGT Ccaggtttat cagcaatcaa ttgcggccgt gtgcaatctt gattggccga ggtccaactt
cttggttcag gtattggatg attcggacga tccgacgacg cagacactga tcagagaaga ggtgctcaag tggcagcaga
acggcgctcg gattgtgtac cggcatcgtg tccttaggga tggttataag gctggaaatc tcaagtcggc gatgagctgc
agctatgtca aggactatga gtttgttgcc atctttgatg cggacttcca accgaatccg gacttcttga agcgaaccgt
gccacatttc aaggtaaatt gagatgaatt ttgtgcctat agtttgtggt gataatgtat atggtttagg gttctaatta
tgattcattt gtttgctgtt gcaggacaat gatgaattgg ggctagtgca agcaagatgg tcatttgtga ataaggatga
gaacctattg actcgtctgc aaaacattaa tctttgcttc cactttgagg tagaacagca agtgaatggg atattcctaa
acttcttcgg gttcaatggc actgctggtg tgtggagaat caaggcattg gatgactcgg gagggtggat ggagcgtaca
acagtggagg acatggacat tgcagtccgg gcacacctta ggggctggaa atttatcttc ctgaatgacg tcgaggtact
atatatgaca aactttctga ataacttgtt gggttatgtt tcttcacctt ttcagttgaa ataacccatt tccctcatta
tggacagtgc caatgtgaat tgccagagtc atacgaagct tataggaagc agcagcatcg gtggcattct ggtccaatgc
agctattcag actctgctta ccagacatta tcaaatgcaa ggtactgatt tgctcttatt tgttgtagTA CTTTATTTTT
GTAAACATCT AAACAATGAA CTTATATAAC CAAATGTTGT TATGAGATAT CCGATTGGTC TGGATAAATA TATCTGTTAA
TGCAAACACG AAATAAAATT AAGGCTTTAC AGCATTTTTT CCCGTATCCA TTCTGTGCAA CTTTGTCTTC AAATAGCATG
TCAGATATAT CATTTAATCC GTTTATTACT TAAAGTGAAA ATTTGAACAT CAACAGGTAA ATAATGTGAT CTTGACAAAA
AAAAGTGTGT TCGGTGCTTT TGTTGGATAC ACAACACGCG CTCATGGCAT CGCGAATATG CTCCAAGGAT GTTAACATGA
TGAAATTCTA AAATGTTAGA GGTTTTTTTA TACTCTTTAA CTGATTCTCG AAATATTAAT TCACATATTG ATATGTCCTG
TACCATTAGC CTTTTCTCTC AAGTACTTAG GTTTATACAC TTCAATAAAG ACGCATGCTC ATCGAGCAGC ATCCATCTCA
CTAGAATATA AAATGTTGAT ATCTAATTGT ATATCATTTG TGCGCATGTT ACAACTGGAC CTTTTTTTGC ATTACCATGA
TAGAATATGA ATTTGCTTAT CACCTTTTGT TGTCATTGTC ATCAAAATAA TGTACTACCT GATAGGATGT CTGGATGAAA
CAACTGACTT GTTGATAGCT CTGTTTTACC AATCTGATTG CTAGATGAAA CAACTGGCTT GTTGATAGCT CTGTTTTACC
AATCTgattg cttattaatt ttgttttatt ctgctgcaga ttgtgttttg gaagaaagcc aacttgatct tccttttctt
ccttctccgg aagctcatac taccattcta ctctttcacg ctcttctgca tcatcctccc aatgacgatg tttgtgcctg
aagccgagct tcctgactgg gtcgtatgct acattcctgc cctgatgtcc ttgctcaaca tcctgccttc tccgaagtct
ttccctttca tcatcccata cctacttttc gagaacacca tgtccgtgac aaaattcaat gccatgatct ctggtctgtt
ccagcttgga aatgcatacg agtgggtggt gaccaagaag tcaggccgat catcggaggg cgacctcatt tctttggcac
ccaaagagtt gaaacaccaa aaaactgaat cggcgcctaa cctcgacgct attgcaaagg agcagtccgc tcctagaaag
gacgtaaaga agaagcacaa ccggatatac aagaaagagc ttgcactctc attgctcctc ctaaccgctg cagctcgcag
tttgctctcg aaacagggta tacatttcta cttcctcctg ttccagggca tatctttctt gttagtaggc cttgatctca
taggcgagca GATTGAGTAA ACTGTGAAAA GCATGATAGA TGTTAAAAAA ACAGTGACAA TGGAGGGTGC TCCAGGGATG
TTGTGTCGAA GCTCTTTGGC GATATTGAAA TGTTGCATGA CGCAATTGTG TCGTCCAATT GATTTATGTC ACGACTTCAC
ACAACATGAT CCACAATGTA CACGCCCAAA TAGGCCCCTC CCCCCTCGGT TGTGTAGATA TAGTTGTTCT TGGACTGTAA
ATTTGCCTAG TTATTCCAAG ACTATCCGAT TCTTTTGTAA ACC

Locus: Os03g0770800

Loading...

Locus: Os03g0770800

Loading...