Os03t0780600-01

Locus

Os03g0780600

Description

Tubulin beta-1 chain (Beta-1 tubulin).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TUB7

CGSNL Gene Name

BETA-TUBULIN 7

Oryzabase Gene Symbol Synonym(s)

OsTUB7, TUBB7, pTUB22

Oryzabase Gene Name Synonym(s)

beta tubulin 7, Tubulin beta-7 chain, Beta-7-tubulin

Transcript Evidence

AK120180 (DDBJ, Best hit)

Protein Evidence

P37832 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: microtubule-based process (GO:0007017)

Biological Process: microtubule-based movement (GO:0007018)

Biological Process: protein polymerization (GO:0051258)

Cellular Component: microtubule (GO:0005874)

Cellular Component: protein complex (GO:0043234)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: structural molecule activity (GO:0005198)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Tubulin (IPR000217)

Beta tubulin (IPR002453)

Tubulin/FtsZ, GTPase domain (IPR003008)

Tubulin/FtsZ, C-terminal (IPR008280)

Beta tubulin, autoregulation binding site (IPR013838)

Tubulin, conserved site (IPR017975)

Tubulin/FtsZ, 2-layer sandwich domain (IPR018316)

Tubulin, C-terminal (IPR023123)

Full-length cDNA

J013033M18 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0780600-01)

RiceXPro (AK120180)

Others

Oryzabase (2962)

KEGG (Os03t0780600-01)

Transcript

1738 bp

>Os03t0780600-01 Tubulin beta-1 chain (Beta-1 tubulin).
ACCCAAGCAAGCAACCCCGTCTCCTCCGCTTCGCTACTCTCCTCGTCGTCTCCGGCTCCG
GCTCCGGTTTCCGGCGAGCGGCGGCGCGATCCCGGGCGGCGAAGGAGGGGGAAGCCATGA
GGGAGATCCTCCACATCCAGGGCGGGCAGTGCGGGAACCAGATCGGGGCCAAGTTCTGGG
AGGTGATCTGCGACGAGCATGGCGTGGACGCGACGGGGCGGTACGCGGGGGACTCCGACC
TGCAGCTGGAGCGGATCAACGTCTACTACAACGAGGCGAGCGGCGGGAGGTACGTGCCCC
GCGCCGTGCTCATGGACCTCGAGCCCGGGACCATGGACTCCGTGCGCTCCGGCCCCTTCG
GCCAGATCTTCCGCCCCGACAACTTCGTCTTCGGGCAGTCCGGCGCCGGAAACAACTGGG
CCAAGGGGCACTACACCGAGGGCGCCGAGCTCATCGACTCCGTCCTCGACGTCGTCCGCA
AGGAGGCCGAGAACTGCGACTGCTTACAAGGATTCCAAGTTTGCCATTCATTGGGAGGAG
GCACTGGATCTGGCATGGGAACCCTTCTTATTTCTAAGATTAGGGAGGAGTACCCGGATA
GAATGATGTTGACATTTTCCGTCTTCCCATCACCAAAGGTCTCGGATACTGTTGTGGAGC
CTTACAATGCTACCCTTTCTGTTCACCAACTTGTTGAGAATGCTGATGAATGTATGGTGC
TTGACAATGAAGCTCTCTACGACATATGCTTCCGCACACTAAAGCTTGCTACCCCTACCT
ttggtgacctcaatcatcttatctctgcaaccatgagtggtgttacatgctgcttgaggt
tccctggtcagctcaactctgatctgcgcaaacttgctgtgaatctcatccctttccccc
gtctccacttcttcatggttggctttgcgccattgacttcacgcggatcacagcagtacc
gtgctctcaccgttcctgagctgacacagcaaatgtgggatgcgaagaacatgatgtgcg
ctgctgatccccgccatggccgctacctcacagcttctgccatgttccgtgggaagatga
gcaccaaggaggtggacgagcagatgctcaatgttcagaacaagaaCTCCTCATACTTTG
TCGAGTGGATTCCCAACAACGTCAAATCCAGTGTCTGTGACATTCCGCCCAGGGGGCTGA
AGATGGCGGCGACCTTCGTCGGGAACTCCACCTCCATCCAAGAGATGTTCCGCCGGGTCA
GCGAGCAGTTCACTGCCATGTTCAGGAGGAAGGCTTTCTTGCACTGGTACACAGGCGAGG
GAATGGACGAGATGGAGTTCACCGAGGCAGAGAGCAACATGAACGATCTCGTCGCGGAGT
ACCAGCAGTACCAGGACGCCACAGCCGATGAAGAGTACGAAGACGAAGAGGAAGAAGCTG
AGGCCGAATAGCATTGAGCCCCATTTGCCCTTCACAGGTTGTTTTGCCAGTGAAGAGTTT
TGTGTCTTTGTGATGCTGTGCTCTTTTTTCTTTCTCTGACGTGCGTGATGGATGTATGGG
TGAGGTTTGCGTCCGTGCTTCGTTTTGTCACCTGTGCTGCGTAGCAGGCTGCAGTCCCGT
TTTGTAAGACGTCTCTGGTGGTCAGTAGCTGAAGGCTTGAAAAGTGTTTTGAGTGCCCTC
CTTGAGCTAAATCACCTGTAAGTTCTGACATGTATTGGTAGTGGTTTTCTCATCTCTG

CDS

1335 bp

>Os03t0780600-01 Tubulin beta-1 chain (Beta-1 tubulin).
ATGAGGGAGATCCTCCACATCCAGGGCGGGCAGTGCGGGAACCAGATCGGGGCCAAGTTC
TGGGAGGTGATCTGCGACGAGCATGGCGTGGACGCGACGGGGCGGTACGCGGGGGACTCC
GACCTGCAGCTGGAGCGGATCAACGTCTACTACAACGAGGCGAGCGGCGGGAGGTACGTG
CCCCGCGCCGTGCTCATGGACCTCGAGCCCGGGACCATGGACTCCGTGCGCTCCGGCCCC
TTCGGCCAGATCTTCCGCCCCGACAACTTCGTCTTCGGGCAGTCCGGCGCCGGAAACAAC
TGGGCCAAGGGGCACTACACCGAGGGCGCCGAGCTCATCGACTCCGTCCTCGACGTCGTC
CGCAAGGAGGCCGAGAACTGCGACTGCTTACAAGGATTCCAAGTTTGCCATTCATTGGGA
GGAGGCACTGGATCTGGCATGGGAACCCTTCTTATTTCTAAGATTAGGGAGGAGTACCCG
GATAGAATGATGTTGACATTTTCCGTCTTCCCATCACCAAAGGTCTCGGATACTGTTGTG
GAGCCTTACAATGCTACCCTTTCTGTTCACCAACTTGTTGAGAATGCTGATGAATGTATG
GTGCTTGACAATGAAGCTCTCTACGACATATGCTTCCGCACACTAAAGCTTGCTACCCCT
ACCTttggtgacctcaatcatcttatctctgcaaccatgagtggtgttacatgctgcttg
aggttccctggtcagctcaactctgatctgcgcaaacttgctgtgaatctcatccctttc
ccccgtctccacttcttcatggttggctttgcgccattgacttcacgcggatcacagcag
taccgtgctctcaccgttcctgagctgacacagcaaatgtgggatgcgaagaacatgatg
tgcgctgctgatccccgccatggccgctacctcacagcttctgccatgttccgtgggaag
atgagcaccaaggaggtggacgagcagatgctcaatgttcagaacaagaaCTCCTCATAC
TTTGTCGAGTGGATTCCCAACAACGTCAAATCCAGTGTCTGTGACATTCCGCCCAGGGGG
CTGAAGATGGCGGCGACCTTCGTCGGGAACTCCACCTCCATCCAAGAGATGTTCCGCCGG
GTCAGCGAGCAGTTCACTGCCATGTTCAGGAGGAAGGCTTTCTTGCACTGGTACACAGGC
GAGGGAATGGACGAGATGGAGTTCACCGAGGCAGAGAGCAACATGAACGATCTCGTCGCG
GAGTACCAGCAGTACCAGGACGCCACAGCCGATGAAGAGTACGAAGACGAAGAGGAAGAA
GCTGAGGCCGAATAG

Protein

445 aa

>Os03t0780600-01 Tubulin beta-1 chain (Beta-1 tubulin).
MREILHIQGGQCGNQIGAKFWEVICDEHGVDATGRYAGDSDLQLERINVYYNEASGGRYV
PRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLATPTFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSSVCDIPPRG
LKMAATFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVA
EYQQYQDATADEEYEDEEEEAEAE*

5'UTR

chr03:32371758..32371873 (+ strand) : 116 bp

CDS

chr03:32371874..32372267 (+ strand) : 394 bp

chr03:32373372..32373641 (+ strand) : 270 bp

chr03:32373740..32374410 (+ strand) : 671 bp

3'UTR

chr03:32374411..32374697 (+ strand) : 287 bp

FASTA

>Os03t0780600-01 class=Sequence position=chr03:32371758..32374697 (+ strand)
ACCCAAGCAA GCAACCCCGT CTCCTCCGCT TCGCTACTCT CCTCGTCGTC TCCGGCTCCG GCTCCGGTTT CCGGCGAGCG
GCGGCGCGAT CCCGGGCGGC GAAGGAGGGG GAAGCCATGA GGGAGATCCT CCACATCCAG GGCGGGCAGT GCGGGAACCA
GATCGGGGCC AAGTTCTGGG AGGTGATCTG CGACGAGCAT GGCGTGGACG CGACGGGGCG GTACGCGGGG GACTCCGACC
TGCAGCTGGA GCGGATCAAC GTCTACTACA ACGAGGCGAG CGGCGGGAGG TACGTGCCCC GCGCCGTGCT CATGGACCTC
GAGCCCGGGA CCATGGACTC CGTGCGCTCC GGCCCCTTCG GCCAGATCTT CCGCCCCGAC AACTTCGTCT TCGGGCAGTC
CGGCGCCGGA AACAACTGGG CCAAGGGGCA CTACACCGAG GGCGCCGAGC TCATCGACTC CGTCCTCGAC GTCGTCCGCA
AGGAGGCCGA GAACTGCGAC TGCTTACAAG GTATCTCATC TCATCTCGCA TGTCCCATTC CGCGTGGTTT AGCTAGATCC
GAGAGAGGCT TTGCACCATC GAGTTAGATC TAGTACGGAT CTGAGCTTGT AGCGGGTGGA AGCGCGATTA ACGTCTTTTT
TTGAAACCAT GGAGTGCGAT TAACATCGGT GCCAGTTTCG CATTTAAGGG AGAAGCGGTT TTAGCATTTA GACATTCCCC
AATTCGTAGT CCTGTTAATT GTAGTGGTGT ATGTATCGAA TTGAACTGTC CATTGCTGTT GATCTTCTCT ATAAGTATGT
CTTCGTGTTA TTTGTTGTAT AGCATGATAA TCTGTCATCT GTGCTACTTG TGTTCTAAAT TCTAATGGCC CAATTTGCAT
TTAGCTTATA ATGCCATTGT GTGACCAATT TTTCATATCT TGGTAGGGAT GTGCCTGTGA GAATTTTAAG CTCCATAAGA
CGCTCTATCA ATCATCAACC TATGTTTTGT ATATGAGCTC CTATTGTCTT ATGTAGCTTG ATCAACATCA ATTGTTGTTG
CCTTGTTGGT GGAATGGGCA TCAACATCAA CACCAATATC TTATCTAGCT CCTACTGTAG CTGTTCTAGA TGTTTACACA
GAACTTTTCT CTTTACCTGT AGTGTCCACC TGTGTCATAG CTGGATTTAA TTCTTTAAAA ACTCAAAACA TAGCAAAATT
GTAACCTTGT CTTTCATGGT TTACAATGAA ATCAAAACTT TATTGCTTTG GTCATCCTTA TGATTATTTA TTTTTGGTAC
AGCTGTACAG GTATAATATT CAACATGATA GACCCAAGTA ATATGCCTTA GTTGAATGCC ATGACAAGTT CATCGACTAA
TAAAGCTTGG TAGAAGAAGA TGTGAAAAAT TGCCTTTGCC TTAATCCATA TAATACCTTC TCTATTGGAA CATGATCAAT
TGCTCCCAAA CTCTGGTTTC GTGGAAGACA CAGTGATACC CTAAACTTCT AGCTGCCCTT GGCCTTTTGA ATGTTGCTAC
ATTCGTTGAA CCCAAGGCTG CCTTTTGTAG ATGCATGTTT GAAGTCTGTT TGCATTGATG ACTAACATCA TGGTCTTATA
TTCTTTACTT GCAGGATTCC AAGTTTGCCA TTCATTGGGA GGAGGCACTG GATCTGGCAT GGGAACCCTT CTTATTTCTA
AGATTAGGGA GGAGTACCCG GATAGAATGA TGTTGACATT TTCCGTCTTC CCATCACCAA AGGTCTCGGA TACTGTTGTG
GAGCCTTACA ATGCTACCCT TTCTGTTCAC CAACTTGTTG AGAATGCTGA TGAATGTATG GTGCTTGACA ATGAAGCTCT
CTACGACATA TGCTTCCGCA CACTAAAGCT TGCTACCCCT ACCTGTAAGT TAGTCTCCTC TTGTTTACTT CTCCATGATA
TCACTAAATt actgttcaac tagaagtagg cactcatagc ttgcttggtt ctaacaatgc agttggtgac ctcaatcatc
ttatctctgc aaccatgagt ggtgttacat gctgcttgag gttccctggt cagctcaact ctgatctgcg caaacttgct
gtgaatctca tccctttccc ccgtctccac ttcttcatgg ttggctttgc gccattgact tcacgcggat cacagcagta
ccgtgctctc accgttcctg agctgacaca gcaaatgtgg gatgcgaaga acatgatgtg cgctgctgat ccccgccatg
gccgctacct cacagcttct gccatgttcc gtgggaagat gagcaccaag gaggtggacg agcagatgct caatgttcag
aacaagaaCT CCTCATACTT TGTCGAGTGG ATTCCCAACA ACGTCAAATC CAGTGTCTGT GACATTCCGC CCAGGGGGCT
GAAGATGGCG GCGACCTTCG TCGGGAACTC CACCTCCATC CAAGAGATGT TCCGCCGGGT CAGCGAGCAG TTCACTGCCA
TGTTCAGGAG GAAGGCTTTC TTGCACTGGT ACACAGGCGA GGGAATGGAC GAGATGGAGT TCACCGAGGC AGAGAGCAAC
ATGAACGATC TCGTCGCGGA GTACCAGCAG TACCAGGACG CCACAGCCGA TGAAGAGTAC GAAGACGAAG AGGAAGAAGC
TGAGGCCGAA TAGCATTGAG CCCCATTTGC CCTTCACAGG TTGTTTTGCC AGTGAAGAGT TTTGTGTCTT TGTGATGCTG
TGCTCTTTTT TCTTTCTCTG ACGTGCGTGA TGGATGTATG GGTGAGGTTT GCGTCCGTGC TTCGTTTTGT CACCTGTGCT
GCGTAGCAGG CTGCAGTCCC GTTTTGTAAG ACGTCTCTGG TGGTCAGTAG CTGAAGGCTT GAAAAGTGTT TTGAGTGCCC
TCCTTGAGCT AAATCACCTG TAAGTTCTGA CATGTATTGG TAGTGGTTTT CTCATCTCTG 

Locus: Os03g0780600

Loading...

Locus: Os03g0780600

Loading...