Os03t0780800-01

Locus

Os03g0780800

Description

Fatty acid 2-hydroxylase, Resistance to rice blast fungus infection

RAP-DB Gene Symbol Synonym(s)

FAH2, Os-FAH2, OsFAH2

RAP-DB Gene Name Synonym(s)

FATTY ACID 2-HYDROXYLASE 2, fatty acid 2-hydroxylase 2

CGSNL Gene Symbol

FAH2

CGSNL Gene Name

FATTY ACID 2-HYDROXYLASE 2

Oryzabase Gene Symbol Synonym(s)

Os-FAH2, OsFAH2

Oryzabase Gene Name Synonym(s)

fatty acid 2-hydroxylase 2

Transcript Evidence

AK103085

Protein Evidence

Q9AY73

Literature

PMID: 27465023

Note

Manual Curation

September 21, 2016

Gene Ontology (GO)

Biological Process: fatty acid biosynthetic process (GO:0006633)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Fatty acid hydroxylase (IPR006694)

Full-length cDNA

J033118H09 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0780800-01)

RiceXPro (AK103085)

Others

Oryzabase (21332)

KEGG (Os03t0780800-01)

Transcript

1228 bp

>Os03t0780800-01 Fatty acid 2-hydroxylase, Resistance to rice blast fungus infection
GTAGATGCACCCCTGGAAAACCCAGGTAATTACGAACTAGTCCTTCTCCAGCCCGGCGAC
GCGGGGGAATTTTACAGATAAGCCCTCGGATTCCTTCCCCCTATTCTCCGCTCCTCGCGT
CGTCGTCCTCCGAGAGGGGGAGGAGAAGGCGAGAAGGGGCTCCGGTGGTGGGAGAGGGAG
ACCGCCATTGCCGCTACTTCCGAGTTCAGATTGGGGAAGATGGTTGTCCAGGAGTTCACC
GTTGATCTGAACAAGCCTCTCGTTTTCCAGGTTGGCCATCTTGAGGAACGTTATCAGGAA
TGGGTTCATCAACCTATCGTGAGCAAGGAAGGTCCACGCTTTTTCGGAAATGATGTCCTG
GAGTTCTTGACGCGCACAAAGTGGTTTGCTGTGCCAACCATATGGCTGCCTGTCGTCTGC
TGGTTGCTTGTGAAATCTATTCGGATGGGTCATACTATTCAGGAAGTAGGTCTAATGGCC
CTATTTGGAATATTCATTTGGACATTGATCGAGTATACTTTGCACCGCTTCCTATTCCAC
ATTGAGACCAAAACCTATTGGGCAAACACAGCACATTACCTTCTTCATGGATGCCACCAT
AAGCATCCTATGGACTCACTCAGGCTTGTATTCCCCCCTACTGCAACAGCAATTTTGTGT
GTGCCGTTCTGGAAGCTGGTAGCGTTCTTCGCAACTCCAACTATCACTCCTGCGCTATTT
GGTGGTGGCCTGTTGGGATATGTGATGTATGACTGCACTCACTATTACTTGCACCATGGA
CAACCATCCAAAGAGCCAGCGAAAAATCTCAAGCGGTATCACCTCAACCACCACTTCAGA
ATCCAAAACAAAGGCTTTGGCATCACCTCATCACTCTGGGATTACGTTTTTGGGACATTG
CCTCCGTCGAAGACCACCGGAAAGAACAACTGAGCCACTGACAGAAATGTATTGTTTTGC
ATGAGAAATTTTAGAGGATATGTAATATATATATTAAGTCTAGGCACAACTGCTTGTTTT
GTCTTTCTGGGACAACAGGTTCACATGCCCATTCAGTTCGAATTCCTGTGGTTTACTGAT
GACTGCCTTGATGTGGGTGAAGAAGACATTTCATTGCCTTGACATCCAATGTTCTGAATT
CAGATAATAGGCAGTTCTTGATGTGATCCATATGCCATGTTAAGCTTAGCAATTCTATTG
GCATGTCCAATTACAAAATGTTTGTCTT

CDS

714 bp

>Os03t0780800-01 Fatty acid 2-hydroxylase, Resistance to rice blast fungus infection
ATGGTTGTCCAGGAGTTCACCGTTGATCTGAACAAGCCTCTCGTTTTCCAGGTTGGCCAT
CTTGAGGAACGTTATCAGGAATGGGTTCATCAACCTATCGTGAGCAAGGAAGGTCCACGC
TTTTTCGGAAATGATGTCCTGGAGTTCTTGACGCGCACAAAGTGGTTTGCTGTGCCAACC
ATATGGCTGCCTGTCGTCTGCTGGTTGCTTGTGAAATCTATTCGGATGGGTCATACTATT
CAGGAAGTAGGTCTAATGGCCCTATTTGGAATATTCATTTGGACATTGATCGAGTATACT
TTGCACCGCTTCCTATTCCACATTGAGACCAAAACCTATTGGGCAAACACAGCACATTAC
CTTCTTCATGGATGCCACCATAAGCATCCTATGGACTCACTCAGGCTTGTATTCCCCCCT
ACTGCAACAGCAATTTTGTGTGTGCCGTTCTGGAAGCTGGTAGCGTTCTTCGCAACTCCA
ACTATCACTCCTGCGCTATTTGGTGGTGGCCTGTTGGGATATGTGATGTATGACTGCACT
CACTATTACTTGCACCATGGACAACCATCCAAAGAGCCAGCGAAAAATCTCAAGCGGTAT
CACCTCAACCACCACTTCAGAATCCAAAACAAAGGCTTTGGCATCACCTCATCACTCTGG
GATTACGTTTTTGGGACATTGCCTCCGTCGAAGACCACCGGAAAGAACAACTGA

Protein

238 aa

>Os03t0780800-01 Fatty acid 2-hydroxylase, Resistance to rice blast fungus infection
MVVQEFTVDLNKPLVFQVGHLEERYQEWVHQPIVSKEGPRFFGNDVLEFLTRTKWFAVPT
IWLPVVCWLLVKSIRMGHTIQEVGLMALFGIFIWTLIEYTLHRFLFHIETKTYWANTAHY
LLHGCHHKHPMDSLRLVFPPTATAILCVPFWKLVAFFATPTITPALFGGGLLGYVMYDCT
HYYLHHGQPSKEPAKNLKRYHLNHHFRIQNKGFGITSSLWDYVFGTLPPSKTTGKNN*

5'UTR

chr03:32375907..32376110 (+ strand) : 204 bp

chr03:32376790..32376804 (+ strand) : 15 bp

CDS

chr03:32376805..32376855 (+ strand) : 51 bp

chr03:32377123..32377215 (+ strand) : 93 bp

chr03:32377287..32377483 (+ strand) : 197 bp

chr03:32377569..32377674 (+ strand) : 106 bp

chr03:32377803..32377949 (+ strand) : 147 bp

chr03:32378049..32378168 (+ strand) : 120 bp

3'UTR

chr03:32378169..32378463 (+ strand) : 295 bp

FASTA

>Os03t0780800-01 class=Sequence position=chr03:32375907..32378463 (+ strand)
GTAGATGCAC CCCTGGAAAA CCCAGGTAAT TACGAACTAG TCCTTCTCCA GCCCGGCGAC GCGGGGGAAT TTTACAGATA
AGCCCTCGGA TTCCTTCCCC CTATTCTCCG CTCCTCGCGT CGTCGTCCTC CGAGAGGGGG AGGAGAAGGC GAGAAGGGGC
TCCGGTGGTG GGAGAGGGAG ACCGCCATTG CCGCTACTTC CGAGGTACGT CGGTGACCTA CTCGATCCCG GGTGAAGTCT
TGGTGGTTTT GGATGTGGGT TTGTGCCCCG TTCGTGTCGG TTCTTGATGG CCGCCGCCGC ATTGCTTTGT TGCTTCGTTC
TTGGCAAGTA TGGCATTCGT CGTCGTTGTC GTCGTCTAGT TTAGTTGCTG GTGCGAAATT CTAGTGGGGG TTTTAGGGAT
CTCGTGGATT GACCGATGGC GACTTGGAGA TCGAGTACTT CTTGGTGGGA AGGAAAAGAT TGGATCTAGA ACGAGATTTT
TCCGTGCCTG CATTTGTCGT GGCGGCATGG TTCGAGTCAG ATTCGTGTGA ACAGGAAAAG GGCAATCTCT TGTGATGGCA
CTAGTTCTTG CCAAATTCGT GTGAACGATC GTTGTGCACT GTAAACGAGG AGATGGAGAT GAAGCTTGGT TGCTGTTGCT
GTTGTGTTAG TGGAGTCCCA TGTGTGTGAT TGTCCAGTCA AAGAAACGTT AGCGTGGGGC AGTGCAAAAA GTTGGTGATT
ATGGTACCCT CTTTAGTAAT TAGGATATGT GTTTAATAGC ATCCTGCGGC TGTCAGCATT GGTAGGATGT ATTTGTGGTA
CAGTTAGTGT TGCTTTTGGA TCTTGTCTCT GAGTTGTGAT TGTTCAGTTT GTGTATATAA TGATGTGTGA TTCTGTGATG
CAGTTCAGAT TGGGGAAGAT GGTTGTCCAG GAGTTCACCG TTGATCTGAA CAAGCCTCTC GTTTTCCAGG TTTTGATTTG
CTCTCTATCA GTGGTCTTTT GCGAATAGTT TTTTTGCGTC ACTTGTCCTT GAAAATCATA CCGTTGCCAT GCTCACCTTC
TTATTGTTTT TTAGCTTCTT GCATACAATT CTTAGTTTCT GACCATAAGG TCAGTTGCTC AAATGTCAAA TTCTGATTTT
CTAGCAATGC GCTGTAAAAT TCTGGATTCT AAGTAAAACT AGTTCAGTTG CTTTGCATTT GGAGTAACAT TTGTTTGTGG
TGTGAATTTG ATGAAGGTTG GCCATCTTGA GGAACGTTAT CAGGAATGGG TTCATCAACC TATCGTGAGC AAGGAAGGTC
CACGCTTTTT CGGAAATGAT GTCCTGGAGG TATTATACAT TCCAATTATT ATTTAGGATT TTGTAAACTG AGCTGTCATA
ACATAACTTT TTGTGTCCAG TTCTTGACGC GCACAAAGTG GTTTGCTGTG CCAACCATAT GGCTGCCTGT CGTCTGCTGG
TTGCTTGTGA AATCTATTCG GATGGGTCAT ACTATTCAGG AAGTAGGTCT AATGGCCCTA TTTGGAATAT TCATTTGGAC
ATTGATCGAG TATACTTTGC ACCGCTTCCT ATTCCACATT GAGACCAAAA CCTATTGGTA AGAATTTATC AACCTTGAGC
TGGTTATTCT ATTGTTATTT TTTCTTTCTT CTCAGCGAGT GGCTCTGAAT GTGATATTGC AGGGCAAACA CAGCACATTA
CCTTCTTCAT GGATGCCACC ATAAGCATCC TATGGACTCA CTCAGGCTTG TATTCCCCCC TACTGCAACA GCAATTTTGT
GTGTGCCGGT ACTTCCCTTA ACCCATTGTA CAAGCATAGA ATCTGATGAG ACTGTATACT TATGTTTCCA TTCAAAAATT
GTATCCACAA AACATGGTCC ATTTAAATCG AAGTGGTTAA CGGCTTCCCT TTTCAGTTCT GGAAGCTGGT AGCGTTCTTC
GCAACTCCAA CTATCACTCC TGCGCTATTT GGTGGTGGCC TGTTGGGATA TGTGATGTAT GACTGCACTC ACTATTACTT
GCACCATGGA CAACCATCCA AAGAGCCAGC GAAAAATCTC AAGGTGACAA CTTAGTGCCA CTTATAAAGC TATAGATTAT
CTAGCTGTTC CAACCAAAGT CCATGAGGCT TGTATTCCTT ACAACGTTTG CTCGTTATGC AGCGGTATCA CCTCAACCAC
CACTTCAGAA TCCAAAACAA AGGCTTTGGC ATCACCTCAT CACTCTGGGA TTACGTTTTT GGGACATTGC CTCCGTCGAA
GACCACCGGA AAGAACAACT GAGCCACTGA CAGAAATGTA TTGTTTTGCA TGAGAAATTT TAGAGGATAT GTAATATATA
TATTAAGTCT AGGCACAACT GCTTGTTTTG TCTTTCTGGG ACAACAGGTT CACATGCCCA TTCAGTTCGA ATTCCTGTGG
TTTACTGATG ACTGCCTTGA TGTGGGTGAA GAAGACATTT CATTGCCTTG ACATCCAATG TTCTGAATTC AGATAATAGG
CAGTTCTTGA TGTGATCCAT ATGCCATGTT AAGCTTAGCA ATTCTATTGG CATGTCCAAT TACAAAATGT TTGTCTT

Locus: Os03g0780800

Loading...

Locus: Os03g0780800

Loading...