Os03t0780800-02

Locus

Os03g0780800

Description

Fatty acid hydroxylase domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

FAH2

CGSNL Gene Name

FATTY ACID 2-HYDROXYLASE 2

Oryzabase Gene Symbol Synonym(s)

Os-FAH2, OsFAH2

Oryzabase Gene Name Synonym(s)

fatty acid 2-hydroxylase 2

Transcript Evidence

AK059874 (DDBJ, Best hit)

Protein Evidence

NP_001149139.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: fatty acid biosynthetic process (GO:0006633)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Fatty acid hydroxylase (IPR006694)

Full-length cDNA

006-207-F06 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0780800-02)

RiceXPro (AK059874)

Others

Oryzabase (21332)

KEGG (Os03t0780800-02)

Transcript

1045 bp

>Os03t0780800-02 Fatty acid hydroxylase domain containing protein.
CTATTCTCCGCTCCTCGCGTCGTCGTCCTCCGAGAGGGGGAGGAGAAGGCGAGAAGGGGC
TCCGGTGGTGGGAGAGGGAGACCGCCATTGCCGCTACTTCCGAGTTCAGATTGGGGAAGA
TGGTTGTCCAGGAGTTCACCGTTGATCTGAACAAGCCTCTCGTTTTCCAGGTTGGCCATC
TTGAGGAACGTTATCAGGAATGGGTTCATCAACCTATCGTGAGCAAGGAAGGTCCACGCT
TTTTCGGAAATGATGTCCTGGAGTTCTTGACGCGCACAAAGTGGTTTGCTGTGCCAACCA
TATGGCTGCCTGTCGTCTGCTGGTTGCTTGTGAAATCTATTCGGATGGGTCATACTATTC
AGGAAGTAGGTCTAATGGCCCTATTTGGAATATTCATTTGGACATTGATCGAGTATACTT
TGCACCGCTTCCTATTCCACATTGAGACCAAAACCTATTGGGCAAACACAGCACATTACC
TTCTTCATGGATGCCACCATAAGCATCCTATGGACTCACTCAGGCTTGTATTCCCCCCTA
CTGCAACAGCAATTTTGTGTGTGCCGTTCTGGAAGCTGGTAGCGTTCTTCGCAACTCCAA
CTATCACTCCTGCGCTATTTGGTGGTGGCCTGTTGGGATATGTGATGTATGACTGCACTC
ACTATTACTTGCACCATGGACAACCATCCAAAGAGCCAGCGAAAAATCTCAAGCGGTATC
ACCTCAACCACCACTTCAGAATCCAAAACAAAGGCTTTGGCATCACCTCATCACTCTGGG
ATTACGTTTTTGGGACATTGCCTCCGTCGAAGACCACCGGAAAGAACAACTGAGCCACTG
ACAGAAATGTATTGTTTTGCATGAGAAATTTTAGAGGATATGTAATATATATATTAAGTC
TAGGCACAACTGCTTGTTTTGTCTTTCTGGGACAACAGGTTCACATGCCCATTCAGTTCG
AATTCCTGTGGTTTACTGATGACTGCCTTGATGTGGGTGAAGAAGACATTTCATTGCCTT
GACATCCAATGTTCTGAATTCAGAT

CDS

714 bp

>Os03t0780800-02 Fatty acid hydroxylase domain containing protein.
ATGGTTGTCCAGGAGTTCACCGTTGATCTGAACAAGCCTCTCGTTTTCCAGGTTGGCCAT
CTTGAGGAACGTTATCAGGAATGGGTTCATCAACCTATCGTGAGCAAGGAAGGTCCACGC
TTTTTCGGAAATGATGTCCTGGAGTTCTTGACGCGCACAAAGTGGTTTGCTGTGCCAACC
ATATGGCTGCCTGTCGTCTGCTGGTTGCTTGTGAAATCTATTCGGATGGGTCATACTATT
CAGGAAGTAGGTCTAATGGCCCTATTTGGAATATTCATTTGGACATTGATCGAGTATACT
TTGCACCGCTTCCTATTCCACATTGAGACCAAAACCTATTGGGCAAACACAGCACATTAC
CTTCTTCATGGATGCCACCATAAGCATCCTATGGACTCACTCAGGCTTGTATTCCCCCCT
ACTGCAACAGCAATTTTGTGTGTGCCGTTCTGGAAGCTGGTAGCGTTCTTCGCAACTCCA
ACTATCACTCCTGCGCTATTTGGTGGTGGCCTGTTGGGATATGTGATGTATGACTGCACT
CACTATTACTTGCACCATGGACAACCATCCAAAGAGCCAGCGAAAAATCTCAAGCGGTAT
CACCTCAACCACCACTTCAGAATCCAAAACAAAGGCTTTGGCATCACCTCATCACTCTGG
GATTACGTTTTTGGGACATTGCCTCCGTCGAAGACCACCGGAAAGAACAACTGA

Protein

238 aa

>Os03t0780800-02 Fatty acid hydroxylase domain containing protein.
MVVQEFTVDLNKPLVFQVGHLEERYQEWVHQPIVSKEGPRFFGNDVLEFLTRTKWFAVPT
IWLPVVCWLLVKSIRMGHTIQEVGLMALFGIFIWTLIEYTLHRFLFHIETKTYWANTAHY
LLHGCHHKHPMDSLRLVFPPTATAILCVPFWKLVAFFATPTITPALFGGGLLGYVMYDCT
HYYLHHGQPSKEPAKNLKRYHLNHHFRIQNKGFGITSSLWDYVFGTLPPSKTTGKNN*

5'UTR

chr03:32376007..32376110 (+ strand) : 104 bp

chr03:32376790..32376804 (+ strand) : 15 bp

CDS

chr03:32376805..32376855 (+ strand) : 51 bp

chr03:32377123..32377215 (+ strand) : 93 bp

chr03:32377287..32377483 (+ strand) : 197 bp

chr03:32377569..32377674 (+ strand) : 106 bp

chr03:32377803..32377949 (+ strand) : 147 bp

chr03:32378049..32378168 (+ strand) : 120 bp

3'UTR

chr03:32378169..32378380 (+ strand) : 212 bp

FASTA

>Os03t0780800-02 class=Sequence position=chr03:32376007..32378380 (+ strand)
CTATTCTCCG CTCCTCGCGT CGTCGTCCTC CGAGAGGGGG AGGAGAAGGC GAGAAGGGGC TCCGGTGGTG GGAGAGGGAG
ACCGCCATTG CCGCTACTTC CGAGGTACGT CGGTGACCTA CTCGATCCCG GGTGAAGTCT TGGTGGTTTT GGATGTGGGT
TTGTGCCCCG TTCGTGTCGG TTCTTGATGG CCGCCGCCGC ATTGCTTTGT TGCTTCGTTC TTGGCAAGTA TGGCATTCGT
CGTCGTTGTC GTCGTCTAGT TTAGTTGCTG GTGCGAAATT CTAGTGGGGG TTTTAGGGAT CTCGTGGATT GACCGATGGC
GACTTGGAGA TCGAGTACTT CTTGGTGGGA AGGAAAAGAT TGGATCTAGA ACGAGATTTT TCCGTGCCTG CATTTGTCGT
GGCGGCATGG TTCGAGTCAG ATTCGTGTGA ACAGGAAAAG GGCAATCTCT TGTGATGGCA CTAGTTCTTG CCAAATTCGT
GTGAACGATC GTTGTGCACT GTAAACGAGG AGATGGAGAT GAAGCTTGGT TGCTGTTGCT GTTGTGTTAG TGGAGTCCCA
TGTGTGTGAT TGTCCAGTCA AAGAAACGTT AGCGTGGGGC AGTGCAAAAA GTTGGTGATT ATGGTACCCT CTTTAGTAAT
TAGGATATGT GTTTAATAGC ATCCTGCGGC TGTCAGCATT GGTAGGATGT ATTTGTGGTA CAGTTAGTGT TGCTTTTGGA
TCTTGTCTCT GAGTTGTGAT TGTTCAGTTT GTGTATATAA TGATGTGTGA TTCTGTGATG CAGTTCAGAT TGGGGAAGAT
GGTTGTCCAG GAGTTCACCG TTGATCTGAA CAAGCCTCTC GTTTTCCAGG TTTTGATTTG CTCTCTATCA GTGGTCTTTT
GCGAATAGTT TTTTTGCGTC ACTTGTCCTT GAAAATCATA CCGTTGCCAT GCTCACCTTC TTATTGTTTT TTAGCTTCTT
GCATACAATT CTTAGTTTCT GACCATAAGG TCAGTTGCTC AAATGTCAAA TTCTGATTTT CTAGCAATGC GCTGTAAAAT
TCTGGATTCT AAGTAAAACT AGTTCAGTTG CTTTGCATTT GGAGTAACAT TTGTTTGTGG TGTGAATTTG ATGAAGGTTG
GCCATCTTGA GGAACGTTAT CAGGAATGGG TTCATCAACC TATCGTGAGC AAGGAAGGTC CACGCTTTTT CGGAAATGAT
GTCCTGGAGG TATTATACAT TCCAATTATT ATTTAGGATT TTGTAAACTG AGCTGTCATA ACATAACTTT TTGTGTCCAG
TTCTTGACGC GCACAAAGTG GTTTGCTGTG CCAACCATAT GGCTGCCTGT CGTCTGCTGG TTGCTTGTGA AATCTATTCG
GATGGGTCAT ACTATTCAGG AAGTAGGTCT AATGGCCCTA TTTGGAATAT TCATTTGGAC ATTGATCGAG TATACTTTGC
ACCGCTTCCT ATTCCACATT GAGACCAAAA CCTATTGGTA AGAATTTATC AACCTTGAGC TGGTTATTCT ATTGTTATTT
TTTCTTTCTT CTCAGCGAGT GGCTCTGAAT GTGATATTGC AGGGCAAACA CAGCACATTA CCTTCTTCAT GGATGCCACC
ATAAGCATCC TATGGACTCA CTCAGGCTTG TATTCCCCCC TACTGCAACA GCAATTTTGT GTGTGCCGGT ACTTCCCTTA
ACCCATTGTA CAAGCATAGA ATCTGATGAG ACTGTATACT TATGTTTCCA TTCAAAAATT GTATCCACAA AACATGGTCC
ATTTAAATCG AAGTGGTTAA CGGCTTCCCT TTTCAGTTCT GGAAGCTGGT AGCGTTCTTC GCAACTCCAA CTATCACTCC
TGCGCTATTT GGTGGTGGCC TGTTGGGATA TGTGATGTAT GACTGCACTC ACTATTACTT GCACCATGGA CAACCATCCA
AAGAGCCAGC GAAAAATCTC AAGGTGACAA CTTAGTGCCA CTTATAAAGC TATAGATTAT CTAGCTGTTC CAACCAAAGT
CCATGAGGCT TGTATTCCTT ACAACGTTTG CTCGTTATGC AGCGGTATCA CCTCAACCAC CACTTCAGAA TCCAAAACAA
AGGCTTTGGC ATCACCTCAT CACTCTGGGA TTACGTTTTT GGGACATTGC CTCCGTCGAA GACCACCGGA AAGAACAACT
GAGCCACTGA CAGAAATGTA TTGTTTTGCA TGAGAAATTT TAGAGGATAT GTAATATATA TATTAAGTCT AGGCACAACT
GCTTGTTTTG TCTTTCTGGG ACAACAGGTT CACATGCCCA TTCAGTTCGA ATTCCTGTGG TTTACTGATG ACTGCCTTGA
TGTGGGTGAA GAAGACATTT CATTGCCTTG ACATCCAATG TTCTGAATTC AGAT

Locus: Os03g0780800

Loading...

Locus: Os03g0780800

Loading...