Os03t0790600-01

Locus

Os03g0790600

Description

Glutamate carboxypeptidase, Hormone homeostasis, Regulation of developmental processes

RAP-DB Gene Symbol Synonym(s)

GO, go, go1, pla3, PLA3, PLA3/GO

RAP-DB Gene Name Synonym(s)

GOLIATH, goliath, PLASTOCHRON 3, plastochron3, PLASTOCHRON3/GOLIATH

CGSNL Gene Symbol

GO

CGSNL Gene Name

GOLIATH

Oryzabase Gene Symbol Synonym(s)

go, go1, pla3, PLA3, PLA3/GO, OsLBD3-7, LBD3-7

Oryzabase Gene Name Synonym(s)

goliath, PLASTOCHRON 3, plastochron3, PLASTOCHRON3/GOLIATH, lateral organ boundaries domain 3-7

Transcript Evidence

AB447403

Protein Evidence

Q852M4

Literature

PMID: 19228340

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

December 9, 2015

Functional domain (InterPro)

Peptidase M28 (IPR007484)

Transferrin receptor-like, dimerisation domain (IPR007365)

Expression Databases

TENOR (Os03t0790600-01)

Others

Oryzabase (2945)

Transcript

2352 bp

>Os03t0790600-01 Glutamate carboxypeptidase, Hormone homeostasis, Regulation of developmental processes
ATGCCCGCATTAACTAGAGCGCTGCGCTGTGCACTGCTCGCTGCACGGGTGGCACTCGCA
CGCGAGAAAGCACGCCGCGCATTCGCCTCTCACGGCGAAATGCtgtcgcagcccgccgcg
gcgctggctcgcttgccccccgcgtcggtgcgcgtcctcgtcgggttcggggcggcgctg
ctcgtctcgctcgtcgtcctccaccgccgccccgccgcgaggggggcggcgggcggcggc
ggccccgcggagtacgacccggccgcgcggttcctggccctgtccgagggggcgaacgcg
accatcgccgccgacctgcgggcgctcaccgcggggccgcacctcgcggggacgggcgcg
gcggccggcgccgccgcgcgggtgctctcggggttccgcgccgcggggctccgaacccta
acGCGGGAGTACACGCCGCTGCTCTCGTACCCGGGGCACGCCTCCCTCGCGCTGCTCCGC
GCCGACCGGACCCTCCTCGCGCACCTGTCCCTCGACGAGCCGGCGGACGTCGGGCGCCGC
CTCGTGCGGCCGTACCACGCGTACGCCCCGTCCGGCGGGGCCGTCGCGGAGGCGGTGTTC
GTCAACCTCGGCCGCGAGGAGGACTACCTCACGCTGGAGCGGCTCGGGGTGAGCGTCCGC
GGCCGCGTCGCGGTGGCGATCCGAGGAGGAGGCTACCGCGGCGGGGTGGTGCGCCGCGCC
GCGGAAAGGAGCGCCGCTGCCGTTCTCATTGCCGGCCACGCGGACGGCGGGGTCGAGAGG
GGCACGGTAATCCTCGGAGGCCCCGGCGACCCGCTCACCCCCGGGTGGGCCGCCACGGCC
GGGGCGGAGCGCCTGGATTTCGACCACGAGGATGTTAAGCGGCGGTTTCCGGCCATCCCA
TCTATGCCGGTGTCGGGCAAGACGGCTTCGGCTATCATACGGACACTAGGTGGCCCGGCT
TTGCCGGCGGATTGGCAGACCGGAGTTGGACTCCCGGTGGATGTCGGCGGCGTTGGACCT
GGTCCCACTCTGGTCAACTTCACATATCAGGAGGACAGGAAGATGGGCATGATACAGGAT
ATTTTTGCTATTATTAAAGGGTACGAAGAACCTGATCGTTACGTTATCCTTGGTAACCAC
CGAGATGCATGGACCTATGGAGCAGTTGACCCTAACAGCGGGACATCTGCGCTTCTTGAT
ATTGCTCGGCGTCTTGGAATAATGCTGCAGTCAGGCTGGACACCACGGAGGACCATCATT
CTTTGTAGTTGGGATGCCGAAGAGTTTGGAATGTTCTCAAAGATCTCATTTATTTGTGTC
CCGTTTATTTCTTTTCTACATTTTGAAGGTTCTTTTTTCCAGATCGGATCAACTGAATGG
GTCGAAGAGAACCTCGAAGATCTGCAATCGAAAGCTGTAGCTTACTTAAATGTTGATTGT
GCGGTGCAAGGAATTGGGCTTTTTGCTGGTTCTACCCCCCAGTTGGACAACCTCTTGGTC
GATGTTACAAGACAGGTAAAAGATCCAGATGTTGAAGGAAAAACAGTCCATGATACATGG
AATAAAATGACCGGAGGCATCAATATAGAAAGACTTGCCAGAACTGATTCTGACTTTGCT
CCATTTCTACATCATGCTGGGATCCCCTGTATGGATTTATACTATGGAAAAGAATTTCCT
GGATATCATACGGCTCTTGACTCGTATCATTGGATGGAAAAGCATGGTGATCCACTGTTT
CTTCGTCACGTGGCTATTGTGGAGATTTGGGGACTACTGGCCCTTCGATTAGCAGATGAC
CCTGTGCTGCCTTTTGATTATCAAACATACGCTTCCCAGTTGCAGGAGCATGCAAATGCA
TTCTCTAGTATGATGGAAAATAGCAAATGGGTTCATTTGCTGAATAGATCCATTGAAGAT
CTTTCTGATGCAGGCTTAGAATTTCTGAAAGAGGCAAAGAAATTACAGGACCAAAATATA
TCCGATGGGTACTCTCTGATGAGGCGGCGATTGTTGAACGACCGTCTTCTACTTGCTGAA
AGAAGCTTTCTGCAAGCTGATGGACTTCAGGGAAGAGGATGGTTCAAGCATCTGATGTAC
TCGCCTCCGGAGGACTACGAAAGCAAGCTCTCGTTTTTCCCTGGGGTGGCGGACGCCATC
TCCCGGTCGAGCAATCGAAGCGCGAAAGAACAGCAGGCGGCGGTGCGGCATGAGGTGCGG
AAAATCTCTAGGGCAATCCAAAGAGCAGCTGATGTTCTTAGAGGCGAATTCAGTAATAGG
AACGAATCTTTATACTCTAGCCTTTCTGTGGCTCCATAAAAACTGTGTATAAATAAAATC
GATTGGGGTTTG

CDS

2319 bp

>Os03t0790600-01 Glutamate carboxypeptidase, Hormone homeostasis, Regulation of developmental processes
ATGCCCGCATTAACTAGAGCGCTGCGCTGTGCACTGCTCGCTGCACGGGTGGCACTCGCA
CGCGAGAAAGCACGCCGCGCATTCGCCTCTCACGGCGAAATGCtgtcgcagcccgccgcg
gcgctggctcgcttgccccccgcgtcggtgcgcgtcctcgtcgggttcggggcggcgctg
ctcgtctcgctcgtcgtcctccaccgccgccccgccgcgaggggggcggcgggcggcggc
ggccccgcggagtacgacccggccgcgcggttcctggccctgtccgagggggcgaacgcg
accatcgccgccgacctgcgggcgctcaccgcggggccgcacctcgcggggacgggcgcg
gcggccggcgccgccgcgcgggtgctctcggggttccgcgccgcggggctccgaacccta
acGCGGGAGTACACGCCGCTGCTCTCGTACCCGGGGCACGCCTCCCTCGCGCTGCTCCGC
GCCGACCGGACCCTCCTCGCGCACCTGTCCCTCGACGAGCCGGCGGACGTCGGGCGCCGC
CTCGTGCGGCCGTACCACGCGTACGCCCCGTCCGGCGGGGCCGTCGCGGAGGCGGTGTTC
GTCAACCTCGGCCGCGAGGAGGACTACCTCACGCTGGAGCGGCTCGGGGTGAGCGTCCGC
GGCCGCGTCGCGGTGGCGATCCGAGGAGGAGGCTACCGCGGCGGGGTGGTGCGCCGCGCC
GCGGAAAGGAGCGCCGCTGCCGTTCTCATTGCCGGCCACGCGGACGGCGGGGTCGAGAGG
GGCACGGTAATCCTCGGAGGCCCCGGCGACCCGCTCACCCCCGGGTGGGCCGCCACGGCC
GGGGCGGAGCGCCTGGATTTCGACCACGAGGATGTTAAGCGGCGGTTTCCGGCCATCCCA
TCTATGCCGGTGTCGGGCAAGACGGCTTCGGCTATCATACGGACACTAGGTGGCCCGGCT
TTGCCGGCGGATTGGCAGACCGGAGTTGGACTCCCGGTGGATGTCGGCGGCGTTGGACCT
GGTCCCACTCTGGTCAACTTCACATATCAGGAGGACAGGAAGATGGGCATGATACAGGAT
ATTTTTGCTATTATTAAAGGGTACGAAGAACCTGATCGTTACGTTATCCTTGGTAACCAC
CGAGATGCATGGACCTATGGAGCAGTTGACCCTAACAGCGGGACATCTGCGCTTCTTGAT
ATTGCTCGGCGTCTTGGAATAATGCTGCAGTCAGGCTGGACACCACGGAGGACCATCATT
CTTTGTAGTTGGGATGCCGAAGAGTTTGGAATGTTCTCAAAGATCTCATTTATTTGTGTC
CCGTTTATTTCTTTTCTACATTTTGAAGGTTCTTTTTTCCAGATCGGATCAACTGAATGG
GTCGAAGAGAACCTCGAAGATCTGCAATCGAAAGCTGTAGCTTACTTAAATGTTGATTGT
GCGGTGCAAGGAATTGGGCTTTTTGCTGGTTCTACCCCCCAGTTGGACAACCTCTTGGTC
GATGTTACAAGACAGGTAAAAGATCCAGATGTTGAAGGAAAAACAGTCCATGATACATGG
AATAAAATGACCGGAGGCATCAATATAGAAAGACTTGCCAGAACTGATTCTGACTTTGCT
CCATTTCTACATCATGCTGGGATCCCCTGTATGGATTTATACTATGGAAAAGAATTTCCT
GGATATCATACGGCTCTTGACTCGTATCATTGGATGGAAAAGCATGGTGATCCACTGTTT
CTTCGTCACGTGGCTATTGTGGAGATTTGGGGACTACTGGCCCTTCGATTAGCAGATGAC
CCTGTGCTGCCTTTTGATTATCAAACATACGCTTCCCAGTTGCAGGAGCATGCAAATGCA
TTCTCTAGTATGATGGAAAATAGCAAATGGGTTCATTTGCTGAATAGATCCATTGAAGAT
CTTTCTGATGCAGGCTTAGAATTTCTGAAAGAGGCAAAGAAATTACAGGACCAAAATATA
TCCGATGGGTACTCTCTGATGAGGCGGCGATTGTTGAACGACCGTCTTCTACTTGCTGAA
AGAAGCTTTCTGCAAGCTGATGGACTTCAGGGAAGAGGATGGTTCAAGCATCTGATGTAC
TCGCCTCCGGAGGACTACGAAAGCAAGCTCTCGTTTTTCCCTGGGGTGGCGGACGCCATC
TCCCGGTCGAGCAATCGAAGCGCGAAAGAACAGCAGGCGGCGGTGCGGCATGAGGTGCGG
AAAATCTCTAGGGCAATCCAAAGAGCAGCTGATGTTCTTAGAGGCGAATTCAGTAATAGG
AACGAATCTTTATACTCTAGCCTTTCTGTGGCTCCATAA

Protein

773 aa

>Os03t0790600-01 Glutamate carboxypeptidase, Hormone homeostasis, Regulation of developmental processes
MPALTRALRCALLAARVALAREKARRAFASHGEMLSQPAAALARLPPASVRVLVGFGAAL
LVSLVVLHRRPAARGAAGGGGPAEYDPAARFLALSEGANATIAADLRALTAGPHLAGTGA
AAGAAARVLSGFRAAGLRTLTREYTPLLSYPGHASLALLRADRTLLAHLSLDEPADVGRR
LVRPYHAYAPSGGAVAEAVFVNLGREEDYLTLERLGVSVRGRVAVAIRGGGYRGGVVRRA
AERSAAAVLIAGHADGGVERGTVILGGPGDPLTPGWAATAGAERLDFDHEDVKRRFPAIP
SMPVSGKTASAIIRTLGGPALPADWQTGVGLPVDVGGVGPGPTLVNFTYQEDRKMGMIQD
IFAIIKGYEEPDRYVILGNHRDAWTYGAVDPNSGTSALLDIARRLGIMLQSGWTPRRTII
LCSWDAEEFGMFSKISFICVPFISFLHFEGSFFQIGSTEWVEENLEDLQSKAVAYLNVDC
AVQGIGLFAGSTPQLDNLLVDVTRQVKDPDVEGKTVHDTWNKMTGGINIERLARTDSDFA
PFLHHAGIPCMDLYYGKEFPGYHTALDSYHWMEKHGDPLFLRHVAIVEIWGLLALRLADD
PVLPFDYQTYASQLQEHANAFSSMMENSKWVHLLNRSIEDLSDAGLEFLKEAKKLQDQNI
SDGYSLMRRRLLNDRLLLAERSFLQADGLQGRGWFKHLMYSPPEDYESKLSFFPGVADAI
SRSSNRSAKEQQAAVRHEVRKISRAIQRAADVLRGEFSNRNESLYSSLSVAP*

CDS

chr03:32859014..32860063 (+ strand) : 1050 bp

chr03:32860963..32861205 (+ strand) : 243 bp

chr03:32861422..32861643 (+ strand) : 222 bp

chr03:32861789..32861857 (+ strand) : 69 bp

chr03:32864095..32864182 (+ strand) : 88 bp

chr03:32864561..32864644 (+ strand) : 84 bp

chr03:32864908..32864996 (+ strand) : 89 bp

chr03:32865347..32865460 (+ strand) : 114 bp

chr03:32865927..32866061 (+ strand) : 135 bp

chr03:32866261..32866485 (+ strand) : 225 bp

3'UTR

chr03:32866486..32866518 (+ strand) : 33 bp

FASTA

>Os03t0790600-01 class=Sequence position=chr03:32859014..32866518 (+ strand)
ATGCCCGCAT TAACTAGAGC GCTGCGCTGT GCACTGCTCG CTGCACGGGT GGCACTCGCA CGCGAGAAAG CACGCCGCGC
ATTCGCCTCT CACGGCGAAA TGCtgtcgca gcccgccgcg gcgctggctc gcttgccccc cgcgtcggtg cgcgtcctcg
tcgggttcgg ggcggcgctg ctcgtctcgc tcgtcgtcct ccaccgccgc cccgccgcga ggggggcggc gggcggcggc
ggccccgcgg agtacgaccc ggccgcgcgg ttcctggccc tgtccgaggg ggcgaacgcg accatcgccg ccgacctgcg
ggcgctcacc gcggggccgc acctcgcggg gacgggcgcg gcggccggcg ccgccgcgcg ggtgctctcg gggttccgcg
ccgcggggct ccgaacccta acGCGGGAGT ACACGCCGCT GCTCTCGTAC CCGGGGCACG CCTCCCTCGC GCTGCTCCGC
GCCGACCGGA CCCTCCTCGC GCACCTGTCC CTCGACGAGC CGGCGGACGT CGGGCGCCGC CTCGTGCGGC CGTACCACGC
GTACGCCCCG TCCGGCGGGG CCGTCGCGGA GGCGGTGTTC GTCAACCTCG GCCGCGAGGA GGACTACCTC ACGCTGGAGC
GGCTCGGGGT GAGCGTCCGC GGCCGCGTCG CGGTGGCGAT CCGAGGAGGA GGCTACCGCG GCGGGGTGGT GCGCCGCGCC
GCGGAAAGGA GCGCCGCTGC CGTTCTCATT GCCGGCCACG CGGACGGCGG GGTCGAGAGG GGCACGGTAA TCCTCGGAGG
CCCCGGCGAC CCGCTCACCC CCGGGTGGGC CGCCACGGCC GGGGCGGAGC GCCTGGATTT CGACCACGAG GATGTTAAGC
GGCGGTTTCC GGCCATCCCA TCTATGCCGG TGTCGGGCAA GACGGCTTCG GCTATCATAC GGACACTAGG TGGCCCGGCT
TTGCCGGCGG ATTGGCAGAC CGGAGTTGGA CTCCCGGTGG ATGTCGGCGG CGTTGGACCT GGTCCCACTC TGGTCAACTT
CACATATCAG GTATAAAATA CAAATCGCCT GGAGGATTGT CTATCTATGA TTACTCGCTT AGAGACAAGG ACGCTGGGTA
CGTTTGCAGG GAAACAGGAA TCAAAGCCAT GGACCGCTCC TTTGACCTAT CTTGACTGGG TTTTCCAGTG ATAGGCTGTT
GCCATTTTGT TTTCAACTTA AGAGAGACGT CTGTGCTGAA TGGGGAAAGA GTCATCGTAG TAGTCCATGT TGTAAACTGC
CGTGTTGAGA TTCTGGATAA GCTCCTAAAT TGTTTGAGCT GTAAAAGATG TCACTACATT TGCAGTTTGA TTAGGAAGCA
CAGTAACCAT TTCCTTGTCC GCTTGACTAT TTTGGTTTCA GTGGACAGTG GTCCTAGCAC CTGTTGTTTT ATTAGCCCTT
TTTTATATCT GTGGTAGTGT GTACAAAACT ACAAATAGCA TTATGCTTGA TGTTGAGCGT ATTGACCAGC CTTTGCTCCT
TTGTAGTGCA TATTGGTTAA ACTTAGTTAG ATTATTATTG TTACAGATTT ATACAGAATG AGAAATATTA TTGTGGGCAT
ACTGAGCTAT GAGCACCAAA TCATTGAGCA CTTGTGACGT AAGTTTTGCA AGTGGTATGC TTTTATGGCT CCCTTTGTTA
TGTTGCTGTA GGCCTATTTG TCATTATTCT GTGTTGTTTC TATATGCTGG ATCTGTTGTC ATGTCTCTCA ATTGGATGAG
CTATATATAT TGGACAAATA AAGCATTGCA TAATAGCTGT CCGTGCTTGT CCTCCAGGCA AGTTAGTGTT TCAGGATGCA
TCTTTTCTTT TGCACAGTTT TGCATATTTG TATAACTGGC AGATGAGACT ATGTTTTAGA GTTAAGTACA ATCAAGACCA
TAATGGTTTT CTCTTATATC TTATTTAAGG AGGACAGGAA GATGGGCATG ATACAGGATA TTTTTGCTAT TATTAAAGGG
TACGAAGAAC CTGATCGTTA CGTTATCCTT GGTAACCACC GAGATGCATG GACCTATGGA GCAGTTGACC CTAACAGCGG
GACATCTGCG CTTCTTGATA TTGCTCGGCG TCTTGGAATA ATGCTGCAGT CAGGCTGGAC ACCACGGAGG ACCATCATTC
TTTGTAGTTG GGATGCCGAA GAGTTTGGAA TGGTGAGTTC ATATTAAAGA AAATTGAGAA TATGTTGCTG AACACCATGT
GAAAAAGGAA ACCATGCAGA TGCCCCCACA CCCTAACATT TTCAAAGTAA CATATATGGC ATTTGCATTT TATGAAAGGA
ACCCCACAAA AAAATCATAT ATAGTTGGCA TGTTCGTAGC TATCCTTTTG AATGAACTTT TCTGGTTGAT TTGATTCATC
TGTCACAGTT CTCAAAGATC TCATTTATTT GTGTCCCGTT TATTTCTTTT CTACATTTTG AAGGTTCTTT TTTCCAGATC
GGATCAACTG AATGGGTCGA AGAGAACCTC GAAGATCTGC AATCGAAAGC TGTAGCTTAC TTAAATGTTG ATTGTGCGGT
GCAAGGAATT GGGCTTTTTG CTGGTTCTAC CCCCCAGTTG GACAACCTCT TGGTCGATGT TACAAGACAG GTAGAGATTA
ATGTGTTTCC ATTGCATTTT TCTATGAGCT TGGGTTTTCA TTTAGAAACC TCAGTCCACT CAGCTATTTA TACCAAATTT
TAGAATTGTT CTGAAGTGAA GTTATGTTTA TTCATTCAGA ACTTTTTGCT TCTAGGTAAA AGATCCAGAT GTTGAAGGAA
AAACAGTCCA TGATACATGG AATAAAATGA CCGGAGGCAT CAATGTAAGA TCTCGAAGGT TTAAACATGC TTTTCTATAT
ACATATTGAG ATGTACTCAA TCCAGGTTGT CACTAGCTGT TCTAAACTGG TTTAAAGTCA AACATCACTT TTATAATAGC
CATCTAGTGG TCACACTTTG TACACTACAG GGTTGGTAAC TTTGAATTAT CTATGCCGAC AACTAATCTT CTGCATAGTG
AGTTACTGAG TTGGTTGTTC TTTTGTTTTG AGTTTTTAGT AGGGTAAGGT ATGCAGTTCT ACATTGGGTG CAGTTGCTCC
AAGTGCAGGG GGCAGGCCCA TATAGATCTC AGTTCCTAGA GTGAGACATC CCCCACACAA GATATACTTA CGAGATGTGC
TAATCTGGTG TCGTCGAATC TTTGTTGTAG TCGACAGTCT ACATGACAAC TATACAAAAA TGAAAGTGAA AATTACTACT
TGCTATGCAC TGATCTTATA CTTCTGACGT GAGCAATTCC TTCTTTCTTT TTTTCAAATC CTTACAAAAC AGGTAATATA
AATACATGAA ATTGTTATTT AGATAAAGAT ATATCGATAT TGGTTTAGTA GAACGCATCA GTGGCACAAA GAACGAACCA
AAAATAATAG TAATAAAAGA TAACGATAAC TTCATGTTTC ATAACTTCAC CTTATATAGG CATCTAGCCC TCACCACCTT
CATGGGCTAA CGCAGGCCCC TGGCTGTGGC CCAGGTGGCC TGGGGCCTGA AAGTGAAAAC CTATTCATAG AAACTAGCCA
AATACAGGCT GGGCCAACCC GGAATTAAGC CCCTGACCAC CTTAAAGCTA GTTGGGGGTG GCACCTCCAA GATAACCCTC
TAATTATTAG GACTATCACA TAGTATGAAT TAACTAATTA CTTGGTATCT GGCTGGTTGA TCTTTCAAAA TTGTTTCGCT
GAAATTCTTT GTCAGAATTT TTGAAAAACC TTCTGAATGA AATATGGTCA ACAATTTATC CATCAGCAAT GATTAGTTGG
CATGAACAGC TAATTTTGTA ACATCTGGAA TGACTCCCAC TCATTTTTGT GTCAAGCCCA CGTCATAATT ACTCCAAGCA
CTCCAAATGA TGGCTTCCAT AAATACCATG GAAAGCTCCA AACCTTACAA AATGTCATTT GCTTTCCACG ACAATCAGAT
TTACCATTTA AGGGCGATAC CTTTATGTAG AAAAAATTTC CGTTCTGTTG AAGTTGACAT GGCTGTACCA GTTGAAGGTG
CATGTGAAAG TCAGCTGTAT CGGTTGCAGA GAATAATCGC TACTCGGTTG TCTCCATCAA GTTGAGCATG CAAGGTCTGG
ATCCCACATG CAATCTTAGT GCTAGTCAAA ATTCACACTT TCTACATAGA ATTGTGGAAT AAGATAATAA CCAAATTGTG
TCGATGGATA TTCCAGTTCC AATAAATTAG GCTACAAACT ACCTGTACCT GGTTATACAT TTTTTGTGTT GCATACTGTT
ACATATTAAG AATATGCAGT CCGGGTTTAT CACTGGACTA ACTTTGGTCA AGGAGCATCA AGGTGTGATG CATCACCCAG
TTGCTCACTC AACAACTGTC TCAAGTCCCA CTGTCCCTTT GAAACTCTTG TTTCCGACCA TGCAATTAGA TGCCTTGGCC
CATTGCTTCT CAAGGCCTCA ACCACATACT AAGTGCTATA CAACTTGGTC CCTACCATGT TAACCCAGCC AGGACGTCTG
AAATAATTGT CCTAACTGGC GCGGGGAAAA CCTCACCTAT ATCAGGCACA TGTATGTCCC ACTTTCCCAT GCCTATTTAC
CAGCGGGTGC ACAAATACAA TGTAGATTGA TGAGGTACCT ATGATGTGTA TGATTAAAAT CATGTGTATG TGTGAAGTGT
AGAACTGTAA ATTAGGCAAC TAATTTCCAC AGCCAGTTCA CGTGTCCATG ACACTCCATC TGTCTTGTTC CCTGTCTTCA
ATGAACAAAC TGCTTATTGT GGTCCTCCTT GCTGTAGTAC CTTCCATCAC CTCACTTGTG TGCCTGAAGG GTGAGTTTCT
GGCGCAGGAG GCCAAGCATT CTGCCAGACG CCCGAGGAGC CATTCCATCT ACTTCACTCT GATTTTGTCT AAACTTTTTT
ATTGTGCTGT AAATTAATTA CTATCGCTTG CTACCGTAAG TGAAAAAAAA TTCTGGTTAT GATCTTTTGA GCGTCTAACT
CATATATATG TTCTGATTAT TTACTGACAA TGAATTCGCA GATAGAAAGA CTTGCCAGAA CTGATTCTGA CTTTGCTCCA
TTTCTACATC ATGCTGGGAT CCCCTGTATG GATTTATACT ATGGAAAAGG TATTTTAAGC ATGCAATCAC GTCTTTCTGT
TTATTATTGT TAAATTAACT TATAACTTTC CTTTTCCTTC TCCAATATAG CATGTAATAT ACGGAGAAAA AGACTTGCTT
TTTTTGCTCA AAAAATAAAC TGTTTTTTTC TCAAAAGAGA GAACAGTATA TGTTTTCTAA GCAGAGGACA TTAATGCAAC
CCCATTTTTT AGGATCGTTA CTGCTTGCTC ATTTTTTAAA ATATTTTGTT GAGCTATGTG ATTTAATTTT GTACATCTCT
CAATCGTTTC CTGGTTCCAA GATAAAGTTA GAAGAGACAA AATATTTCCC CATCACCCCA CTTTCTAGAG AGAATGCAGG
ACATCATCTA ACTGGTCTAA TACGCAGAAT TTCCTGGATA TCATACGGCT CTTGACTCGT ATCATTGGAT GGAAAAGCAT
GGTGATCCAC TGTTTCTTCG TCACGTGGCT AGTAAGTAGC AGTAATGATC TTTTAAAATG ATTCTGAAAG GGAGAAAATG
TGCAATACCT TACAAACTAC AATTTTGCTT GTTCAAATTA CTGTTAACTT GAATGCACTG GTACAAGACC AGTCAATTAT
TATAAAAATT CTATGGACTA TCCCATATAG AACTAGACAT AAGGTCGCAG CTGAGTTTGG TATTTTTGTG CTTTAAAATA
TGTTGTACAC ATCTCTTATA ATACTCATCA TGCTCATTTA CTTTGGCTCA ACAGTTGTGG AGATTTGGGG ACTACTGGCC
CTTCGATTAG CAGATGACCC TGTGCTGCCT TTTGATTATC AAACATACGC TTCCCAGTTG CAGGTACATC GATTCTTTCA
GAATTAGCAC AAGCATTTAA CATTTTCATA TGATTGGCAT TTATCATCCT GAAGGACTGT ACGTGTATGT TTATGTAGCA
TATTCAATTT TTGCTTATGC AATGGGAGCT TGACCCAAAA ACAGGGTTTT GCTCAAAACA ACATTGTAAT TGACAATTTT
GAATGCACAT ATGCTCAATC TAGTTGAACT GAACTTTAGA ACACAAATAT AAGTCACGCA TGATGACCAA CTTCATGGGT
TCATAGATCA TATTAGAGTA GGGGTATATT TCCTTTTCCC ACAGCATCAT GGTCTCATCT TCTGATGTAC ATTTTGAACT
TGCAATGTCG CAGGAGCATG CAAATGCATT CTCTAGTATG ATGGAAAATA GCAAATGGGT TCATTTGCTG AATAGATCCA
TTGAAGATCT TTCTGATGCA GGCTTAGAAT TTCTGAAAGA GGCAAAGGTA TGTTCAAGAA TCTTTTTTTC TTTTGCTTTA
TATTCTGTTT TGTCTTTCTG TTTCCATGTA ATTAGGTAGT CTGTAGTCCA TTATAGTTGC GGTTGGCTGA AGATATTTTC
TTCTTTAGCT CTTTCACTCT GCACACTGCA TATCACTTCT GTATGTACAA CCAGTTTGAA ACGGCAGTAT GTATATTTGG
ATATCCAATT TTATTTAGAC ATTTGCCTTT TGCAGTTTTG CTGCACATAC AGGCAATAAC TTTAATTTCT TAGAACTTAG
TAATCCTTTT GGTGCCTGAC ATCACATTAT TGATGCTTTC TCTTAAAAAT TATTATATCA GTACAGTTAT TTTTCCATTC
CCATGATGGA TGCCATTTAT TTTGCCACTT GGATCTCATG TTTTAAATAT TTTGTACCAA TCTATATTGC CGATGATAAC
CTTATTTTCT TTTGTTGATT TGGAACATTC TAGAAATTAC AGGACCAAAA TATATCCGAT GGGTACTCTC TGATGAGGCG
GCGATTGTTG AACGACCGTC TTCTACTTGC TGAAAGAAGC TTTCTGCAAG CTGATGGACT TCAGGGAAGA GGATGGTTCA
AGCATCTGGT GAGCCTTaag tgggtcagcc atgaacccac ttataggtca aaataagcag gtctgcggct tattttggcc
tataagtggg tttcgcgggt tagccactta cactcttaAG CCTCCCGCTA TTCATAAGTC ATAAGTCATA ACCAAATTTA
GAAAAAAAAA ATGTTGTGCG TGACCACGCT TTTATATTTC TTGCTAGATG TACTCGCCTC CGGAGGACTA CGAAAGCAAG
CTCTCGTTTT TCCCTGGGGT GGCGGACGCC ATCTCCCGGT CGAGCAATCG AAGCGCGAAA GAACAGCAGG CGGCGGTGCG
GCATGAGGTG CGGAAAATCT CTAGGGCAAT CCAAAGAGCA GCTGATGTTC TTAGAGGCGA ATTCAGTAAT AGGAACGAAT
CTTTATACTC TAGCCTTTCT GTGGCTCCAT AAAAACTGTG TATAAATAAA ATCGATTGGG GTTTG