Os03t0790600-02

Locus

Os03g0790600

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GO

CGSNL Gene Name

GOLIATH

Oryzabase Gene Symbol Synonym(s)

go, go1, pla3, PLA3, PLA3/GO, OsLBD3-7, LBD3-7

Oryzabase Gene Name Synonym(s)

goliath, PLASTOCHRON 3, plastochron3, PLASTOCHRON3/GOLIATH, lateral organ boundaries domain 3-7

Transcript Evidence

AK106495 (DDBJ, Best hit)

Protein Evidence

NP_001120724.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Transferrin receptor-like, dimerisation domain (IPR007365)

Full-length cDNA

002-105-D02 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0790600-02)

RiceXPro (AK106495)

Others

Oryzabase (2945)

KEGG (Os03t0790600-02 (EC:3.4.17.21))

Transcript

2033 bp

>Os03t0790600-02 Similar to predicted protein.
CAGCAATGATTAGTTGGCATGAACAGCTAATTTTGTAACATCTGGAATGACTCCCACTCA
TTTTTGTGTCAAGCCCACGTCATAATTACTCCAAGCACTCCAAATGATGGCTTCCATAAA
TACCATGGAAAGCTCCAAACCTTACAAAATGTCATTTGCTTTCCACGACAATCAGATTTA
CCATTTAAGGGCGATACCTTTATGTAGAAAAAATTTCCGTTCTGTTGAAGTTGACATGGC
TGTACCAGTTGAAGGTGCATGTGAAAGTCAGCTGTATCGGTTGCAGAGAATAATCGCTAC
TCGGTTGTCTCCATCAAGTTGAGCATGCAAGGTCTGGATCCCACATGCAATCTTAGTGCT
AGTCAAAATTCACACTTTCTACATAGAATTGTGGAATAAGATAATAACCAAATTGTGTCG
ATGGATATTCCAGTTCCAATAAATTAGGCTACAAACTACCTGTACCTGGTTATACATTTT
TTGTGTTGCATACTGTTACATATTAAGAATATGCAGTCCGGGTTTATCACTGGACTAACT
TTGGTCAAGGAGCATCAAGGTGTGATGCATCACCCAGTTGCTCACTCAACAACTGTCTCA
AGTCCCACTGTCCCTTTGAAACTCTTGTTTCCGACCATGCAATTAGATGCCTTGGCCCAT
TGCTTCTCAAGGCCTCAACCACATACTAAGTGCTATACAACTTGGTCCCTACCATGTTAA
CCCAGCCAGGACGTCTGAAATAATTGTCCTAACTGGCGCGGGGAAAACCTCACCTATATC
AGGCACATGTATGTCCCACTTTCCCATGCCTATTTACCAGCGGGTGCACAAATACAATGT
AGATTGATGAGGTACCTATGATGTGTATGATTAAAATCATGTGTATGTGTGAAGTGTAGA
ACTGTAAATTAGGCAACTAATTTCCACAGCCAGTTCACGTGTCCATGACACTCCATCTGT
CTTGTTCCCTGTCTTCAATGAACAAACTGCTTATTGTGGTCCTCCTTGCTGTAGTACCTT
CCATCACCTCACTTGTGTGCCTGAAGGGTGAGTTTCTGGCGCAGGAGGCCAAGCATTCTG
CCAGACGCCCGAGGAGCCATTCCATCTACTTCACTCTGATTTTGTCTAAACTTTTTTATT
GTGCTGTAAATTAATTACTATCGCTTGCTACCGTAAGTGAAAAAAAATTCTGGTTATGAT
CTTTTGAGCGTCTAACTCATATATATGTTCTGATTATTTACTGACAATGAATTCGCAGAT
AGAAAGACTTGCCAGAACTGATTCTGACTTTGCTCCATTTCTACATCATGCTGGGATCCC
CTGTATGGATTTATACTATGGAAAAGAATTTCCTGGATATCATACGGCTCTTGACTCGTA
TCATTGGATGGAAAAGCATGGTGATCCACTGTTTCTTCGTCACGTGGCTATTGTGGAGAT
TTGGGGACTACTGGCCCTTCGATTAGCAGATGACCCTGTGCTGCCTTTTGATTATCAAAC
ATACGCTTCCCAGTTGCAGGAGCATGCAAATGCATTCTCTAGTATGATGGAAAATAGCAA
ATGGGTTCATTTGCTGAATAGATCCATTGAAGATCTTTCTGATGCAGGCTTAGAATTTCT
GAAAGAGGCAAAGAAATTACAGGACCAAAATATATCCGATGGGTACTCTCTGATGAGGCG
GCGATTGTTGAACGACCGTCTTCTACTTGCTGAAAGAAGCTTTCTGCAAGCTGATGGACT
TCAGGGAAGAGGATGGTTCAAGCATCTGATGTACTCGCCTCCGGAGGACTACGAAAGCAA
GCTCTCGTTTTTCCCTGGGGTGGCGGACGCCATCTCCCGGTCGAGCAATCGAAGCGCGAA
AGAACAGCAGGCGGCGGTGCGGCATGAGGTGCGGAAAATCTCTAGGGCAATCCAAAGAGC
AGCTGATGTTCTTAGAGGCGAATTCAGTAATAGGAACGAATCTTTATACTCTAGCCTTTC
TGTGGCTCCATAAAAACTGTGTATAAATAAAATCGATTGGGGTTTGAGAAATG

CDS

747 bp

>Os03t0790600-02 Similar to predicted protein.
ATGAATTCGCAGATAGAAAGACTTGCCAGAACTGATTCTGACTTTGCTCCATTTCTACAT
CATGCTGGGATCCCCTGTATGGATTTATACTATGGAAAAGAATTTCCTGGATATCATACG
GCTCTTGACTCGTATCATTGGATGGAAAAGCATGGTGATCCACTGTTTCTTCGTCACGTG
GCTATTGTGGAGATTTGGGGACTACTGGCCCTTCGATTAGCAGATGACCCTGTGCTGCCT
TTTGATTATCAAACATACGCTTCCCAGTTGCAGGAGCATGCAAATGCATTCTCTAGTATG
ATGGAAAATAGCAAATGGGTTCATTTGCTGAATAGATCCATTGAAGATCTTTCTGATGCA
GGCTTAGAATTTCTGAAAGAGGCAAAGAAATTACAGGACCAAAATATATCCGATGGGTAC
TCTCTGATGAGGCGGCGATTGTTGAACGACCGTCTTCTACTTGCTGAAAGAAGCTTTCTG
CAAGCTGATGGACTTCAGGGAAGAGGATGGTTCAAGCATCTGATGTACTCGCCTCCGGAG
GACTACGAAAGCAAGCTCTCGTTTTTCCCTGGGGTGGCGGACGCCATCTCCCGGTCGAGC
AATCGAAGCGCGAAAGAACAGCAGGCGGCGGTGCGGCATGAGGTGCGGAAAATCTCTAGG
GCAATCCAAAGAGCAGCTGATGTTCTTAGAGGCGAATTCAGTAATAGGAACGAATCTTTA
TACTCTAGCCTTTCTGTGGCTCCATAA

Protein

249 aa

>Os03t0790600-02 Similar to predicted protein.
MNSQIERLARTDSDFAPFLHHAGIPCMDLYYGKEFPGYHTALDSYHWMEKHGDPLFLRHV
AIVEIWGLLALRLADDPVLPFDYQTYASQLQEHANAFSSMMENSKWVHLLNRSIEDLSDA
GLEFLKEAKKLQDQNISDGYSLMRRRLLNDRLLLAERSFLQADGLQGRGWFKHLMYSPPE
DYESKLSFFPGVADAISRSSNRSAKEQQAAVRHEVRKISRAIQRAADVLRGEFSNRNESL
YSSLSVAP*

5'UTR

chr03:32862837..32864082 (+ strand) : 1246 bp

CDS

chr03:32864083..32864182 (+ strand) : 100 bp

chr03:32864561..32864644 (+ strand) : 84 bp

chr03:32864908..32864996 (+ strand) : 89 bp

chr03:32865347..32865460 (+ strand) : 114 bp

chr03:32865927..32866061 (+ strand) : 135 bp

chr03:32866261..32866485 (+ strand) : 225 bp

3'UTR

chr03:32866486..32866525 (+ strand) : 40 bp

FASTA

>Os03t0790600-02 class=Sequence position=chr03:32862837..32866525 (+ strand)
CAGCAATGAT TAGTTGGCAT GAACAGCTAA TTTTGTAACA TCTGGAATGA CTCCCACTCA TTTTTGTGTC AAGCCCACGT
CATAATTACT CCAAGCACTC CAAATGATGG CTTCCATAAA TACCATGGAA AGCTCCAAAC CTTACAAAAT GTCATTTGCT
TTCCACGACA ATCAGATTTA CCATTTAAGG GCGATACCTT TATGTAGAAA AAATTTCCGT TCTGTTGAAG TTGACATGGC
TGTACCAGTT GAAGGTGCAT GTGAAAGTCA GCTGTATCGG TTGCAGAGAA TAATCGCTAC TCGGTTGTCT CCATCAAGTT
GAGCATGCAA GGTCTGGATC CCACATGCAA TCTTAGTGCT AGTCAAAATT CACACTTTCT ACATAGAATT GTGGAATAAG
ATAATAACCA AATTGTGTCG ATGGATATTC CAGTTCCAAT AAATTAGGCT ACAAACTACC TGTACCTGGT TATACATTTT
TTGTGTTGCA TACTGTTACA TATTAAGAAT ATGCAGTCCG GGTTTATCAC TGGACTAACT TTGGTCAAGG AGCATCAAGG
TGTGATGCAT CACCCAGTTG CTCACTCAAC AACTGTCTCA AGTCCCACTG TCCCTTTGAA ACTCTTGTTT CCGACCATGC
AATTAGATGC CTTGGCCCAT TGCTTCTCAA GGCCTCAACC ACATACTAAG TGCTATACAA CTTGGTCCCT ACCATGTTAA
CCCAGCCAGG ACGTCTGAAA TAATTGTCCT AACTGGCGCG GGGAAAACCT CACCTATATC AGGCACATGT ATGTCCCACT
TTCCCATGCC TATTTACCAG CGGGTGCACA AATACAATGT AGATTGATGA GGTACCTATG ATGTGTATGA TTAAAATCAT
GTGTATGTGT GAAGTGTAGA ACTGTAAATT AGGCAACTAA TTTCCACAGC CAGTTCACGT GTCCATGACA CTCCATCTGT
CTTGTTCCCT GTCTTCAATG AACAAACTGC TTATTGTGGT CCTCCTTGCT GTAGTACCTT CCATCACCTC ACTTGTGTGC
CTGAAGGGTG AGTTTCTGGC GCAGGAGGCC AAGCATTCTG CCAGACGCCC GAGGAGCCAT TCCATCTACT TCACTCTGAT
TTTGTCTAAA CTTTTTTATT GTGCTGTAAA TTAATTACTA TCGCTTGCTA CCGTAAGTGA AAAAAAATTC TGGTTATGAT
CTTTTGAGCG TCTAACTCAT ATATATGTTC TGATTATTTA CTGACAATGA ATTCGCAGAT AGAAAGACTT GCCAGAACTG
ATTCTGACTT TGCTCCATTT CTACATCATG CTGGGATCCC CTGTATGGAT TTATACTATG GAAAAGGTAT TTTAAGCATG
CAATCACGTC TTTCTGTTTA TTATTGTTAA ATTAACTTAT AACTTTCCTT TTCCTTCTCC AATATAGCAT GTAATATACG
GAGAAAAAGA CTTGCTTTTT TTGCTCAAAA AATAAACTGT TTTTTTCTCA AAAGAGAGAA CAGTATATGT TTTCTAAGCA
GAGGACATTA ATGCAACCCC ATTTTTTAGG ATCGTTACTG CTTGCTCATT TTTTAAAATA TTTTGTTGAG CTATGTGATT
TAATTTTGTA CATCTCTCAA TCGTTTCCTG GTTCCAAGAT AAAGTTAGAA GAGACAAAAT ATTTCCCCAT CACCCCACTT
TCTAGAGAGA ATGCAGGACA TCATCTAACT GGTCTAATAC GCAGAATTTC CTGGATATCA TACGGCTCTT GACTCGTATC
ATTGGATGGA AAAGCATGGT GATCCACTGT TTCTTCGTCA CGTGGCTAGT AAGTAGCAGT AATGATCTTT TAAAATGATT
CTGAAAGGGA GAAAATGTGC AATACCTTAC AAACTACAAT TTTGCTTGTT CAAATTACTG TTAACTTGAA TGCACTGGTA
CAAGACCAGT CAATTATTAT AAAAATTCTA TGGACTATCC CATATAGAAC TAGACATAAG GTCGCAGCTG AGTTTGGTAT
TTTTGTGCTT TAAAATATGT TGTACACATC TCTTATAATA CTCATCATGC TCATTTACTT TGGCTCAACA GTTGTGGAGA
TTTGGGGACT ACTGGCCCTT CGATTAGCAG ATGACCCTGT GCTGCCTTTT GATTATCAAA CATACGCTTC CCAGTTGCAG
GTACATCGAT TCTTTCAGAA TTAGCACAAG CATTTAACAT TTTCATATGA TTGGCATTTA TCATCCTGAA GGACTGTACG
TGTATGTTTA TGTAGCATAT TCAATTTTTG CTTATGCAAT GGGAGCTTGA CCCAAAAACA GGGTTTTGCT CAAAACAACA
TTGTAATTGA CAATTTTGAA TGCACATATG CTCAATCTAG TTGAACTGAA CTTTAGAACA CAAATATAAG TCACGCATGA
TGACCAACTT CATGGGTTCA TAGATCATAT TAGAGTAGGG GTATATTTCC TTTTCCCACA GCATCATGGT CTCATCTTCT
GATGTACATT TTGAACTTGC AATGTCGCAG GAGCATGCAA ATGCATTCTC TAGTATGATG GAAAATAGCA AATGGGTTCA
TTTGCTGAAT AGATCCATTG AAGATCTTTC TGATGCAGGC TTAGAATTTC TGAAAGAGGC AAAGGTATGT TCAAGAATCT
TTTTTTCTTT TGCTTTATAT TCTGTTTTGT CTTTCTGTTT CCATGTAATT AGGTAGTCTG TAGTCCATTA TAGTTGCGGT
TGGCTGAAGA TATTTTCTTC TTTAGCTCTT TCACTCTGCA CACTGCATAT CACTTCTGTA TGTACAACCA GTTTGAAACG
GCAGTATGTA TATTTGGATA TCCAATTTTA TTTAGACATT TGCCTTTTGC AGTTTTGCTG CACATACAGG CAATAACTTT
AATTTCTTAG AACTTAGTAA TCCTTTTGGT GCCTGACATC ACATTATTGA TGCTTTCTCT TAAAAATTAT TATATCAGTA
CAGTTATTTT TCCATTCCCA TGATGGATGC CATTTATTTT GCCACTTGGA TCTCATGTTT TAAATATTTT GTACCAATCT
ATATTGCCGA TGATAACCTT ATTTTCTTTT GTTGATTTGG AACATTCTAG AAATTACAGG ACCAAAATAT ATCCGATGGG
TACTCTCTGA TGAGGCGGCG ATTGTTGAAC GACCGTCTTC TACTTGCTGA AAGAAGCTTT CTGCAAGCTG ATGGACTTCA
GGGAAGAGGA TGGTTCAAGC ATCTGGTGAG CCTTaagtgg gtcagccatg aacccactta taggtcaaaa taagcaggtc
tgcggcttat tttggcctat aagtgggttt cgcgggttag ccacttacac tcttaAGCCT CCCGCTATTC ATAAGTCATA
AGTCATAACC AAATTTAGAA AAAAAAAATG TTGTGCGTGA CCACGCTTTT ATATTTCTTG CTAGATGTAC TCGCCTCCGG
AGGACTACGA AAGCAAGCTC TCGTTTTTCC CTGGGGTGGC GGACGCCATC TCCCGGTCGA GCAATCGAAG CGCGAAAGAA
CAGCAGGCGG CGGTGCGGCA TGAGGTGCGG AAAATCTCTA GGGCAATCCA AAGAGCAGCT GATGTTCTTA GAGGCGAATT
CAGTAATAGG AACGAATCTT TATACTCTAG CCTTTCTGTG GCTCCATAAA AACTGTGTAT AAATAAAATC GATTGGGGTT
TGAGAAATG