Os03t0790600-03

Locus

Os03g0790600

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GO

CGSNL Gene Name

GOLIATH

Oryzabase Gene Symbol Synonym(s)

go, go1, pla3, PLA3, PLA3/GO, OsLBD3-7, LBD3-7

Oryzabase Gene Name Synonym(s)

goliath, PLASTOCHRON 3, plastochron3, PLASTOCHRON3/GOLIATH, lateral organ boundaries domain 3-7

Transcript Evidence

AK063229 (DDBJ, Best hit)

Protein Evidence

NP_001120724.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Transferrin receptor-like, dimerisation domain (IPR007365)

Full-length cDNA

001-112-F03 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0790600-03)

RiceXPro (AK063229)

Others

Oryzabase (2945)

KEGG (Os03t0790600-03)

Transcript

707 bp

>Os03t0790600-03 Similar to predicted protein.
CGTATCATTGGATGGAAAAGCATGGTGATCCACTGTTTCTTCGTCACGTGGCTATTGTGG
AGATTTGGGGACTACTGGCCCTTCGATTAGCAGATGACCCTGTGCTGCCTTTTGATTATC
AAACATACGCTTCCCAGTTGCAGGAGCATGCAAATGCATTCTCTAGTATGATGGAAAATA
GCAAATGGGTTCATTTGCTGAATAGATCCATTGAAGATCTTTCTGATGCAGGCTTAGAAT
TTCTGAAAGAGGCAAAGAAATTACAGGACCAAAATATATCCGATGGGTACTCTCTGATGA
GGCGGCGATTGTTGAACGACCGTCTTCTACTTGCTGAAAGAAGCTTTCTGCAAGCTGATG
GACTTCAGGGAAGAGGATGGTTCAAGCATCTGATGTACTCGCCTCCGGAGGACTACGAAA
GCAAGCTCTCGTTTTTCCCTGGGGTGGCGGACGCCATCTCCCGGTCGAGCAATCGAAGCG
CGAAAGAACAGCAGGCGGCGGTGCGGCATGAGCAACTGCCGGTGCAGGAGCGCGGGCGGG
CGGCGGCGCACCGTCGACGCAGCAGGCTACGACGTCTGCCGCGTGGCAGCTGGAAGACTT
CGCATCTGAATTCTCGTTTCCTTGATTGGCTTCACAACACGTCGACTGATGAGCGATGAG
ACAGAAATCTGTAACATCTTCATGTAATAAAACTGCATTTCATTCTC

CDS

657 bp

>Os03t0790600-03 Similar to predicted protein.
TATCATTGGATGGAAAAGCATGGTGATCCACTGTTTCTTCGTCACGTGGCTATTGTGGAG
ATTTGGGGACTACTGGCCCTTCGATTAGCAGATGACCCTGTGCTGCCTTTTGATTATCAA
ACATACGCTTCCCAGTTGCAGGAGCATGCAAATGCATTCTCTAGTATGATGGAAAATAGC
AAATGGGTTCATTTGCTGAATAGATCCATTGAAGATCTTTCTGATGCAGGCTTAGAATTT
CTGAAAGAGGCAAAGAAATTACAGGACCAAAATATATCCGATGGGTACTCTCTGATGAGG
CGGCGATTGTTGAACGACCGTCTTCTACTTGCTGAAAGAAGCTTTCTGCAAGCTGATGGA
CTTCAGGGAAGAGGATGGTTCAAGCATCTGATGTACTCGCCTCCGGAGGACTACGAAAGC
AAGCTCTCGTTTTTCCCTGGGGTGGCGGACGCCATCTCCCGGTCGAGCAATCGAAGCGCG
AAAGAACAGCAGGCGGCGGTGCGGCATGAGCAACTGCCGGTGCAGGAGCGCGGGCGGGCG
GCGGCGCACCGTCGACGCAGCAGGCTACGACGTCTGCCGCGTGGCAGCTGGAAGACTTCG
CATCTGAATTCTCGTTTCCTTGATTGGCTTCACAACACGTCGACTGATGAGCGATGA

Protein

219 aa

>Os03t0790600-03 Similar to predicted protein.
YHWMEKHGDPLFLRHVAIVEIWGLLALRLADDPVLPFDYQTYASQLQEHANAFSSMMENS
KWVHLLNRSIEDLSDAGLEFLKEAKKLQDQNISDGYSLMRRRLLNDRLLLAERSFLQADG
LQGRGWFKHLMYSPPEDYESKLSFFPGVADAISRSSNRSAKEQQAAVRHEQLPVQERGRA
AAHRRRSRLRRLPRGSWKTSHLNSRFLDWLHNTSTDER*

5'UTR

chr03:32864591..32864592 (+ strand) : 2 bp

CDS

chr03:32864593..32864644 (+ strand) : 52 bp

chr03:32864908..32864996 (+ strand) : 89 bp

chr03:32865347..32865460 (+ strand) : 114 bp

chr03:32865927..32866061 (+ strand) : 135 bp

chr03:32866261..32866380 (+ strand) : 120 bp

chr03:32868689..32868714 (+ strand) : 26 bp

chr03:32868917..32869037 (+ strand) : 121 bp

3'UTR

chr03:32869038..32869085 (+ strand) : 48 bp

FASTA

>Os03t0790600-03 class=Sequence position=chr03:32864591..32869085 (+ strand)
CGTATCATTG GATGGAAAAG CATGGTGATC CACTGTTTCT TCGTCACGTG GCTAGTAAGT AGCAGTAATG ATCTTTTAAA
ATGATTCTGA AAGGGAGAAA ATGTGCAATA CCTTACAAAC TACAATTTTG CTTGTTCAAA TTACTGTTAA CTTGAATGCA
CTGGTACAAG ACCAGTCAAT TATTATAAAA ATTCTATGGA CTATCCCATA TAGAACTAGA CATAAGGTCG CAGCTGAGTT
TGGTATTTTT GTGCTTTAAA ATATGTTGTA CACATCTCTT ATAATACTCA TCATGCTCAT TTACTTTGGC TCAACAGTTG
TGGAGATTTG GGGACTACTG GCCCTTCGAT TAGCAGATGA CCCTGTGCTG CCTTTTGATT ATCAAACATA CGCTTCCCAG
TTGCAGGTAC ATCGATTCTT TCAGAATTAG CACAAGCATT TAACATTTTC ATATGATTGG CATTTATCAT CCTGAAGGAC
TGTACGTGTA TGTTTATGTA GCATATTCAA TTTTTGCTTA TGCAATGGGA GCTTGACCCA AAAACAGGGT TTTGCTCAAA
ACAACATTGT AATTGACAAT TTTGAATGCA CATATGCTCA ATCTAGTTGA ACTGAACTTT AGAACACAAA TATAAGTCAC
GCATGATGAC CAACTTCATG GGTTCATAGA TCATATTAGA GTAGGGGTAT ATTTCCTTTT CCCACAGCAT CATGGTCTCA
TCTTCTGATG TACATTTTGA ACTTGCAATG TCGCAGGAGC ATGCAAATGC ATTCTCTAGT ATGATGGAAA ATAGCAAATG
GGTTCATTTG CTGAATAGAT CCATTGAAGA TCTTTCTGAT GCAGGCTTAG AATTTCTGAA AGAGGCAAAG GTATGTTCAA
GAATCTTTTT TTCTTTTGCT TTATATTCTG TTTTGTCTTT CTGTTTCCAT GTAATTAGGT AGTCTGTAGT CCATTATAGT
TGCGGTTGGC TGAAGATATT TTCTTCTTTA GCTCTTTCAC TCTGCACACT GCATATCACT TCTGTATGTA CAACCAGTTT
GAAACGGCAG TATGTATATT TGGATATCCA ATTTTATTTA GACATTTGCC TTTTGCAGTT TTGCTGCACA TACAGGCAAT
AACTTTAATT TCTTAGAACT TAGTAATCCT TTTGGTGCCT GACATCACAT TATTGATGCT TTCTCTTAAA AATTATTATA
TCAGTACAGT TATTTTTCCA TTCCCATGAT GGATGCCATT TATTTTGCCA CTTGGATCTC ATGTTTTAAA TATTTTGTAC
CAATCTATAT TGCCGATGAT AACCTTATTT TCTTTTGTTG ATTTGGAACA TTCTAGAAAT TACAGGACCA AAATATATCC
GATGGGTACT CTCTGATGAG GCGGCGATTG TTGAACGACC GTCTTCTACT TGCTGAAAGA AGCTTTCTGC AAGCTGATGG
ACTTCAGGGA AGAGGATGGT TCAAGCATCT GGTGAGCCTT aagtgggtca gccatgaacc cacttatagg tcaaaataag
caggtctgcg gcttattttg gcctataagt gggtttcgcg ggttagccac ttacactctt aAGCCTCCCG CTATTCATAA
GTCATAAGTC ATAACCAAAT TTAGAAAAAA AAAATGTTGT GCGTGACCAC GCTTTTATAT TTCTTGCTAG ATGTACTCGC
CTCCGGAGGA CTACGAAAGC AAGCTCTCGT TTTTCCCTGG GGTGGCGGAC GCCATCTCCC GGTCGAGCAA TCGAAGCGCG
AAAGAACAGC AGGCGGCGGT GCGGCATGAG GTGCGGAAAA TCTCTAGGGC AATCCAAAGA GCAGCTGATG TTCTTAGAGG
CGAATTCAGT AATAGGAACG AATCTTTATA CTCTAGCCTT TCTGTGGCTC CATAAAAACT GTGTATAAAT AAAATCGATT
GGGGTTTGAG AAATGAAATC TTGTTCCTGT GCGAAGGTGG TTTTATATTG CGTTTCTTGA CACTACTCTT TTTAGAGGGC
ATTATGCTTA ATTAAAACAA GAAGCCAGGA TTGCAATCTG AACAGCAACA ACAGAAATTA GGAAGTCTGA TGGAAGTCTA
AGCTAAGTTT GAAGAAACTA GGATCGCAGC TATTATTTGC ACCGGCAAAC CAACTATTCC TAGCACCTCA ATTTAGTCTT
TGTTTTTTCA TAACAGAAAA GAAAAGGAGA CCAATAGCAC TTTGGAAAAC CAGTGCATGT TAAACCGCCC ACCAACTACC
AGGGTTTTTA AACCGCCGAG CCCGGAGTTA ACCGCGTAGT AAGGCAAACC CTGCCAACCA CACCTCAAAC CCCCCTTAAA
AAAAACCTAG AGCTCATATT AGCTAGTACt ccctccatcc taaaatattt gacgccgttg actttttaaa aaatgtttga
tcgttcgtct tattaaaaaa ttaattaatt attaattctt ttcctatcat ttgatttatt gttaaatata cttttatgta
tacatatagt tttacatatt tcacaaaagt ttttgaataa gacaaacggt caaacatgtt taaaaaaatc aacggcgtca
aacatttagt gaaagaggga gGGAGTACTT TACTGTACAC CACGTTCATA TTGCTGTGAG CTCAAATTAA ATGGAATAAA
TATAATAACG AAAATCCTAC CAGCTACCCA CAAACGGTAG CCGGCAGGAA CAGCCCAAAC CTGCCTGAAA TGGAACCGCG
AAAAAAACGG AAACGTGGGT AGCGCGCGCG CGCGCTCGCG CTCGCGCATC TGCTCATGCC GTTGCTTAGT ATTCTTTCTC
GTGCAATTAT TCAACTAATC ACAAATAATT ATAGCGTTAA TTTTTTCCCA TGCAAAATAC TCCAACTAGC CGTTGCCACA
CTTCCATGTA GAGACGAATC CACCGTCTCC TCTCCTCTCG TACGCACATA CATAGAGCCG GCCATGGATT TGCCAAATCC
CAATCTCCCC ATGCAAAATC TTGCCAAGAT CCACGAGATC CTGAACCAAA TCTCCATCTC CCCTCCGTGA GATCTCCCGG
TAGATCATGT CCCCCGGTGA GGAGGACGTG GAAGCCAGCA GCGACAGCGG CGGCTCCGCG ACAAGGCGTT GCGCCGCGTG
CAAGTTCCTG CGCAGGCGGT GCTCCCGCGA CTGCGTCCTC GCGCCCCACT TCCCGGCTTC CGATCCCCAC AGATACGCCT
GCGTTCAGCG TGTCTTCGGC GCCGGCAACA CCGCCAGAAT GCTCCAGGTG ATCACTGATC ACTACTACTA GTAGCTAGCT
ATACCACACA TACTACCACA CTCATATTTC TAAACGGAAA TTACACGAGC TGGTATGTTT TTTCTTTTTT TTGAGCGTGG
TATGTTTTTT CACTAAAATA ATTTTACCAT TATTAATAAA AAAAATACCA ATGTAAATCT AGCAGTATTT CGAGGTATCA
AAATTTCTCT TTTCACTATC ACTTGGTAGT GTGCGTGCGT TGGTTTACGT CTTCTATGCA ATTGAAAAAA AAACATATGG
GGCTATATTG GTGTCACTAG CTCACTCACT GTACACCTTA TTCAGTTAGA AGTTGGCACG TGATCGAAGT TGTTACTTGT
TAGTGATAAA ATTGTTGATG tgtagtgtaa ttggggaaag tgaattcatc cctcgagagg atatcccgtc gtttcacata
tgtcacataa atagttatta aaaaatatga aaaaaattta gtaacataga ttaatgtgaa atatatcact ccacaaacat
acaagtttaa attcaacttt tacaagttgt aacaaaaaca acaaatatag ttgtaaatgt gcgataacta ttttcaattt
aatttgttat ttttgttgca acttatagaa attgaatttg gttttgcata tttgtggagt gatatatttt atattaatct
atattgtcaa ttttttttta aattatttaa taactattta gatgacatgc aaacatgtcc tctcgagaga tgaaaatcca
cgtccTAATA ATTGGGCTGC AAATTGGAAC AGAGCTATAC TCCATATGTT AATTTCGCAG TGATGCGCGT CTCAATTCTA
TCGTTGTATT GCGTGCAGCA ACTGCCGGTG CAGGAGCGCG GGCGGGCGGC GGACTCGATG GCGGCGGAGG CGTACCGGCG
GGTGCAGGAC CCGGTGTACG GCTGCGCCGG CGTCATCAAC CGCCTCCAGG ACCAGATCCG CGCCGCCCAG TGCGAGCTCG
CTTGGACCCA CGCGCAGATC GCCATGCACA GCGCCGCCGC CGCCCACGCG CGTACGACCC TTCCGCCGGG GCAGCGAGAC
GGCGGCGGCG GCGGCGCACC GTCGACGCAG CAGGCTACGA CGTCTGCCGC GTGGCAGCTG GAAGACTTCG CATCTGAATT
CTCGTTTCCT TGATTGGCTT CACAACACGT CGACTGATGA GCGATGAGAC AGAAATCTGT AACATCTTCA TGTAATAAAA
CTGCATTTCA TTCTC