Os03t0792900-01

Locus

Os03g0792900

Description

Similar to PVPR3 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SAP6

CGSNL Gene Name

STRESS ASSOCIATED PROTEIN GENE 6

Oryzabase Gene Symbol Synonym(s)

OsSAP6

Oryzabase Gene Name Synonym(s)

stress-associated protein 6

Transcript Evidence

AK102503 (DDBJ, Best hit)

Protein Evidence

Q852K5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, AN1-type (IPR000058)

Zinc finger, A20-type (IPR002653)

Full-length cDNA

J033095D08 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0792900-01)

RiceXPro (AK102503)

Others

Oryzabase (18184)

KEGG (Os03t0792900-01)

Transcript

1158 bp

>Os03t0792900-01 Similar to PVPR3 protein.
GCCCGAAGAAGAAAAAAAAAAGGAAGGAAAAAAAAAAAGAGAAGGCGACGCGAAAAGCAG
AAAGGAAAAAAAAAAAACTCCGTTCTCTCCTGGAAGAACAGGTTGGGGAAGGAGAGGAGA
GGAGAGGAGAGGAGAGGAGAATCCGCGTAGGCTGCCCCCCGCAGATCCGATCGATCGGGC
CTCTCCGGCGAACCCCTCGTCCTCCTCGCGGTGCAGTTGGTGTTCCTTACAATGGCACAA
GAGAGCTGGAAAAAGGAGGCAGAGGAGACTGGAGTCCACACACCTGAGGCCCCTATATTG
TGCGTTAACAACTGTGGCTTCTTTGGCAGCCGGATGACAGAAAACATGTGCTCAAAGTGT
TATAGGGACACCGTTAAGGCCAAGACAGTGGCCACTGTTGTGGAGAAGAAACCTCTTGCT
TCATTGTCTTCCACACCTTTGGTGACAGAAGTCACAGATGGAGGGTCTGGTTCAGTTGCA
GATGGGAAACAAGTAATGGAGGAGGATACACCAAAGCCACCCAGTAACCGTTGCTTATCA
TGCCGGAAGAAGGTTGGGTTGACAGGATTCAAGTGCCGCTGCGGAGGCACCTTCTGTTCA
ATGCACCGCTATGCCGATTCACACAAATGCACATTTGATTACAAGCAGGTCGGGAGGGAG
CAGATTGCCAAACAGAATCCTCTTGTGAAAGCTGACAAGATCACCAAAATCTGATGGCGG
TTCTAGAGGAGCGATGCTCGTTTATTTCCTCATGGTGTTACTTGATCTGTCAAGTTTACT
TCAAGATTATACTTCAGGGGTTGGATGTATCTATCATTCTCCTGGGATTTGCTTTGCCAA
TGAACGCCTTCGACAAACACCACGGATTGATGTCTCTCTAGCACTGGAGCACTGCTCAAT
GCGCTTGGGCACGCCTTCAAGGCTATATTTCTTGGTGTTTGCGTGGGAACTTTGATTGGC
ACAGGTGCACTTCTCCTTATTTGCAGTATGAATAATGTAAATATTTATATTTTATTCAGT
ATGCAATTCTACTGATTATATTATTATGCCCAAGGTTCGCCAGGCTTCCATTATCACCTG
CTACAGTTTGTTTAGATAGATTACTGTGTGTATTGTAGATATAATACTTTTGGTGCCATA
ATGTTGTTATCCAGTGTC

CDS

483 bp

>Os03t0792900-01 Similar to PVPR3 protein.
ATGGCACAAGAGAGCTGGAAAAAGGAGGCAGAGGAGACTGGAGTCCACACACCTGAGGCC
CCTATATTGTGCGTTAACAACTGTGGCTTCTTTGGCAGCCGGATGACAGAAAACATGTGC
TCAAAGTGTTATAGGGACACCGTTAAGGCCAAGACAGTGGCCACTGTTGTGGAGAAGAAA
CCTCTTGCTTCATTGTCTTCCACACCTTTGGTGACAGAAGTCACAGATGGAGGGTCTGGT
TCAGTTGCAGATGGGAAACAAGTAATGGAGGAGGATACACCAAAGCCACCCAGTAACCGT
TGCTTATCATGCCGGAAGAAGGTTGGGTTGACAGGATTCAAGTGCCGCTGCGGAGGCACC
TTCTGTTCAATGCACCGCTATGCCGATTCACACAAATGCACATTTGATTACAAGCAGGTC
GGGAGGGAGCAGATTGCCAAACAGAATCCTCTTGTGAAAGCTGACAAGATCACCAAAATC
TGA

Protein

161 aa

>Os03t0792900-01 Similar to PVPR3 protein.
MAQESWKKEAEETGVHTPEAPILCVNNCGFFGSRMTENMCSKCYRDTVKAKTVATVVEKK
PLASLSSTPLVTEVTDGGSGSVADGKQVMEEDTPKPPSNRCLSCRKKVGLTGFKCRCGGT
FCSMHRYADSHKCTFDYKQVGREQIAKQNPLVKADKITKI*

5'UTR

chr03:32976702..32976911 (- strand) : 210 bp

chr03:32975251..32975271 (- strand) : 21 bp

CDS

chr03:32974768..32975250 (- strand) : 483 bp

3'UTR

chr03:32974324..32974767 (- strand) : 444 bp

FASTA

>Os03t0792900-01 class=Sequence position=chr03:32974324..32976911 (- strand)
GCCCGAAGAA GAAAAAAAAA AGGAAGGAAA AAAAAAAAGA GAAGGCGACG CGAAAAGCAG AAAGGAAAAA AAAAAAACTC
CGTTCTCTCC TGGAAGAACA GGTTGGGGAA GGAGAGGAGA GGAGAGGAGA GGAGAGGAGA ATCCGCGTAG GCTGCCCCCC
GCAGATCCGA TCGATCGGGC CTCTCCGGCG AACCCCTCGT CCTCCTCGCG GTAAGGCTCG ATCTGAGATT GTTTGCTATT
TGGTGGTGGC ATGTAATTTT GCTTGCTGGT ATGGTTGGTT TGTTGAATTG TAAGATGTTT TAGTCTTGGT TGAGGTCGAT
CTAGGATTTG ATGGTCGATC TAGGATTCGA TGAGTAGATT GGCGTGGTTG ATGGTTAGGC ACGGATTAGT ATGTCTCAAT
TTGGTGTGCC TGCTATGATG ATGGATGAAT TGCCTTTGAC TTTTTGGGTA TGAAAACATG GGGGTAAATT TACGCAGAGA
GATTAGTTTC CGGATGGGGT AATTGTTTGT TTATGGCCTT GATTACACGC CGGACGTAGC TTCTTCCATG TGGCGTAGCT
GAGATTTGCA GACCAACATA CCAAGTGCGT TTAGCTGGTA GGATGGCTTT CTTGTGGTGT TCACTTCTGT GGACAGGATA
TTGTTGTCTT GTTGAGGTTT CTTGCGGTTT AGTCAGCAGA GATTGCAATG ATCATGAAGG CAATTGCATC GAATTTTTGT
GATCTAAGCA TGGGAATTCA CAATGGTGTG GTGTTGCTTG CCGACGACGA ATATGGAAAT TGGTGATTGT ACAAGGTATT
TTCATGTGTA TGGAAACGAC AATACATTGT ACCAGCTTAA TATATCATCG CTTCATTTGT TTGCATTGGT TTAGCTCATC
ATGGCACCCT CTCTGTTTTG CTGGGCTGGT CTCACACACA ACTTATTGCA AATAGGCACA TTTTTAGTTT ATCTCCCACA
TATGTGCGTG CTAGGGAATA TTTTTAGCAC CAGGTAATAC ATATTGAAAA GTGAAGTAGT CCAATCTAGA TTCTATCCAT
ATATATGCAT ATTTTTTTCT GTTGATATAT CACCAGGGAA TACCTTTTGA GAATGGGAGT AGCCCAATCA GGTATATGGT
TATGAACTAG TCTGTGTCAA TTGTTGAGGT CTGATCAAAC TCATGTGCTA ACTGCTAAGG CAGTTCCTCT GTCCATAAAT
ATGCCACTTA TTTGGTAATA CTCAGTGAGT ACCTGTGGCA TTTCATCTCA ATGATAGGAA TGGATTACTA AATTCGTGTT
GTATGTGGGG ATGAGTTATT GTCACAGACA GGGCAGTTCC TCCCAATTGT TATTGCCCTT GGGTGATCAG ATGCAATGGA
GTTTTATTAG CACTATTCTT TGTGACCTTG AACCTTATTG GCAGGTACAA CCAACTAAAT TTGTTCTGTA GGTTGGGATG
TTGTCTTGTC ATGCATGGTC TACTCAATTA TATCATGTAA TAAAGTTATA CTCCACACTT GTGAGAAAAT TCTTGCTGAA
GGGGTGATGG CTATCTGACT CTTACCTAGT TCCAACTACC TTATACATTT GGTGCAATGG CCATGTCGAA TGGTCTTGAA
GTTTATTGAT TAATGATTAA GTTGTTATTT TCTATTGAAG GTGCAGTTGG TGTTCCTTAC AATGGCACAA GAGAGCTGGA
AAAAGGAGGC AGAGGAGACT GGAGTCCACA CACCTGAGGC CCCTATATTG TGCGTTAACA ACTGTGGCTT CTTTGGCAGC
CGGATGACAG AAAACATGTG CTCAAAGTGT TATAGGGACA CCGTTAAGGC CAAGACAGTG GCCACTGTTG TGGAGAAGAA
ACCTCTTGCT TCATTGTCTT CCACACCTTT GGTGACAGAA GTCACAGATG GAGGGTCTGG TTCAGTTGCA GATGGGAAAC
AAGTAATGGA GGAGGATACA CCAAAGCCAC CCAGTAACCG TTGCTTATCA TGCCGGAAGA AGGTTGGGTT GACAGGATTC
AAGTGCCGCT GCGGAGGCAC CTTCTGTTCA ATGCACCGCT ATGCCGATTC ACACAAATGC ACATTTGATT ACAAGCAGGT
CGGGAGGGAG CAGATTGCCA AACAGAATCC TCTTGTGAAA GCTGACAAGA TCACCAAAAT CTGATGGCGG TTCTAGAGGA
GCGATGCTCG TTTATTTCCT CATGGTGTTA CTTGATCTGT CAAGTTTACT TCAAGATTAT ACTTCAGGGG TTGGATGTAT
CTATCATTCT CCTGGGATTT GCTTTGCCAA TGAACGCCTT CGACAAACAC CACGGATTGA TGTCTCTCTA GCACTGGAGC
ACTGCTCAAT GCGCTTGGGC ACGCCTTCAA GGCTATATTT CTTGGTGTTT GCGTGGGAAC TTTGATTGGC ACAGGTGCAC
TTCTCCTTAT TTGCAGTATG AATAATGTAA ATATTTATAT TTTATTCAGT ATGCAATTCT ACTGATTATA TTATTATGCC
CAAGGTTCGC CAGGCTTCCA TTATCACCTG CTACAGTTTG TTTAGATAGA TTACTGTGTG TATTGTAGAT ATAATACTTT
TGGTGCCATA ATGTTGTTAT CCAGTGTC

Locus: Os03g0792900

Loading...

Locus: Os03g0792900

Loading...