Os03t0793500-01

Locus

Os03g0793500

Description

Casein kinase I, Photoperiodic control of flowering time, Long-day repression

RAP-DB Gene Symbol Synonym(s)

HD16, Hd16, EL1, CK1

RAP-DB Gene Name Synonym(s)

HEADING DATE 16, EARLY FLOWERING 1, Early flowering1, Casein Kinase I

CGSNL Gene Symbol

HD16

CGSNL Gene Name

HEADING DATE 16

Oryzabase Gene Symbol Synonym(s)

Hd16, EL1, CK1, Hd16/CKI, Hd16/EL1

Oryzabase Gene Name Synonym(s)

EARLY FLOWERING 1, Early flowering1, Casein Kinase I

Transcript Evidence

AK121620

Protein Evidence

Q852L0

Literature

PMID: 23789941

PMID: 20400938

Note

Manual Curation

November 21, 2013

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J033044P16 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0793500-01)

Others

Oryzabase (8704)

KEGG (Os03t0793500-01)

Transcript

2723 bp

>Os03t0793500-01 Casein kinase I, Photoperiodic control of flowering time, Long-day repression
GCAGCAGCCGCAGCAGCAGCAAAGCCTCCCCCCCCAACCCACCACCGCGACACGCACGCG
AGCGACGCGAGCGCTCCACGATTTCTCTGCCTCCCCCCCCCCCTCGGTCTCCTCCTCCCC
CACCACCACCGCACGCTTCCCGAGGCGCCGCCCTCCGCCGCCGCGGGCATCCGCTTCCGA
CGACGATATTGGAAGGAGCACCGAAGGGTGTAGCACAAGGCCGAGTTGCATGGGGCGATA
ATGCCAGAGTTGCGGGGTGGTGTTTGGAGAGCTCGTCTGAGGTCCAAGAAGGTTTACGAC
GTCCAGGACGCAGATCCAGCTGCGAGTCCGGTGTCGCCAGCTCCGCGGGGGAGGACTGGA
AGGCGCGGCGGTGCTGCGGCTGGCAGAGGCAACAAGACAGTTGCTGAGGGAGGAGGGAGG
AAAGCTCTGAAGCCTAGAGGAAAGGGGTGCAGGGCTGTTGATTTGTGTAAGGATCAACCT
TGCAAGGACCTCCCTGAAGTTATTGCTAGAAAGGCGGTTACCGGCAAAGCCCAGGAGGAC
CTTGGTTTGAACAAGGTAGCTGACAGAGCTGCGAACTTGATGATGGACGGCGAAAGTGGA
GACAAATTTGCTGCGGCAGAAGATGAATCCACTACAACACCAGTTCCTGAGCGGGTTCAA
GTAGGCAATTCCCCAGAGTATATAACTGATAGGAAGTTGGGTAAAGGTGGATTTGGTCAG
GTCTATGTTGGTCGAAGAGTATCTGGTGGAGGTTCTCGCACGGGTCCAGATGCGCAAGAG
GTTGCGCTTAAATTTGAGCACCGAAGCAGTAAAGGATGTAACTATGGCCCTCCATACGAG
TGGCAGGTTTACCACACTCTCAATGGTTGTTATGGCATACCATCAGTCCACTATAAGGGT
CGTTTGGGAGACTACTACATTCTTGTAATGGATATGCTTGGTCCCAGCCTCTGGGATGTG
TGGAATTCAGTGGGACAGGCGATGTCTGCCCATATGGTTGCTTGCATTGCTGTGGAAGCG
ATATCAATTCTTGAGAAGCTTCACTCTAAAGGGTTTGTACATGGTGATGTCAAACCAGAG
AATTTTTTGCTTGGTCATCCTGGGTCAGTTGATGAGAAGAAGCTTTTCCTGATTGATCTT
GGTTTAGCATCCAGGTGGAAAGAAGCATCATCTGGTCAGCATGTTGACTATGATCAGAGG
CCAGATGTCTTTAGGGGAACAATTAGATACGCTAGCGTCCATGCCCACTTAGGTCGTACA
GGTAGCAGGAGGGATGATTTAGAGTCACTGGCTTACACCCTAATCTTTTTAATAAGAGGG
AGATTACCTTGGCAAGGGTATCAGGGAGATAACAAGAGTTTTCTTGTTTGTAAGAAGAAA
ATGGCTACTTCACCAGAGTTGCTGTGTTGCTTCTGTCCAGCTCCGTTCAAACATTTTCTA
GAGATGGTCACTAACATGAAATTTGACGAAGAGCCAAACTATCCAAAACTTATTTCTCTC
TTTGATGGTTTGATTGAAGGGCCTGCTTCAAGGCCCATCAGAATTGATGGAGCTCTGAAG
GTTGGGCAAAAACGTGGAAGAATGGTTGTAAATCTTGACGATGATGAACAGCCCAAGAAG
AAAGTTAGGTTGGGAAGCCCAGCAACTCAATGGATCTCAGTTTATAATGCTAGGCGGCCC
ATGAAGCAGAGATATCACTATAATGTTGCTGATTCAAGGCTGCATCAGCATATAGAAAAA
GGCAATGAAGATGGGCTGTACATTAGTTGTGTCTCTTCTTCCGCAAATTTTTGGGCTCTC
ATAATGGATGCTGGGACTGGCTTTTGTTCCCAAGTTTATGAGCTTTCACAAGTGTTTCTG
CACAAGGATTGGATTATGGAGCAGTGGGAGAAGAATTATTACATAACGGCAATAGCAGGA
GCAACCAATGGAAGCTCATTGGTTGTAATGTCCAAAGGAACTCCATACACACAGCAGTCA
TACAAAGTCAGTGAATCCTTTCCTTACAAGTGGATTAACAAAAAGTGGAAAGAAGGTTTC
CATGTGACATCTATGGCTACTGCTGGAAACCGTTGGGGAGTTGTCATGTCAAGAAATGCA
GGCTATTCCCATCAGGTGGTAGAGTTGGACTTTCTATATCCAAGTGAAGGGATCCATCGG
CGATGGGAGACAGGTTACAGAATAACTTCGACTGCAGCAACTCCTGACCAAGCTGCCTTC
ATCTTGAGCATACCAAAGAGGAAGCCAATGGACGAGACACAAGAAACTCTTCGAACTTCC
TCCTTTCCCAGCAACCATGTCAAGGAAAAATGGTCAAAGAACCTATACATCGCTTCAATC
TGCTACGGCCGGACCGTATGCTGACAGCTTCAACATTTCGAAGCTCCAATGTGAAGCCAT
GTCTAGCTACTACTAGCATTTTGCAGTGAGCTGCCAACCGATCAAATCTCCCTTGATTGG
GAGATCTGAAGCAAGGAAAAAAAAAAGAAACAAATCAATGGCTGACATCACCGGCCTCTT
GCAGCCATCTATTCTAACTGTAAAAATTGAAAAAAAAAATCATGGCAAATGTTGTACCAG
ATCGGATATGGAGACCTTTGTCCATAAGCTAAGCTAGTATAAGCTGCATGGCGGTGCTAA
GATCATATTGTTCTCACATACGGAGTATATATATATCATACTACTCTCTCTgtttcagat
tataagatattttgactttggcc

CDS

2124 bp

>Os03t0793500-01 Casein kinase I, Photoperiodic control of flowering time, Long-day repression
ATGCCAGAGTTGCGGGGTGGTGTTTGGAGAGCTCGTCTGAGGTCCAAGAAGGTTTACGAC
GTCCAGGACGCAGATCCAGCTGCGAGTCCGGTGTCGCCAGCTCCGCGGGGGAGGACTGGA
AGGCGCGGCGGTGCTGCGGCTGGCAGAGGCAACAAGACAGTTGCTGAGGGAGGAGGGAGG
AAAGCTCTGAAGCCTAGAGGAAAGGGGTGCAGGGCTGTTGATTTGTGTAAGGATCAACCT
TGCAAGGACCTCCCTGAAGTTATTGCTAGAAAGGCGGTTACCGGCAAAGCCCAGGAGGAC
CTTGGTTTGAACAAGGTAGCTGACAGAGCTGCGAACTTGATGATGGACGGCGAAAGTGGA
GACAAATTTGCTGCGGCAGAAGATGAATCCACTACAACACCAGTTCCTGAGCGGGTTCAA
GTAGGCAATTCCCCAGAGTATATAACTGATAGGAAGTTGGGTAAAGGTGGATTTGGTCAG
GTCTATGTTGGTCGAAGAGTATCTGGTGGAGGTTCTCGCACGGGTCCAGATGCGCAAGAG
GTTGCGCTTAAATTTGAGCACCGAAGCAGTAAAGGATGTAACTATGGCCCTCCATACGAG
TGGCAGGTTTACCACACTCTCAATGGTTGTTATGGCATACCATCAGTCCACTATAAGGGT
CGTTTGGGAGACTACTACATTCTTGTAATGGATATGCTTGGTCCCAGCCTCTGGGATGTG
TGGAATTCAGTGGGACAGGCGATGTCTGCCCATATGGTTGCTTGCATTGCTGTGGAAGCG
ATATCAATTCTTGAGAAGCTTCACTCTAAAGGGTTTGTACATGGTGATGTCAAACCAGAG
AATTTTTTGCTTGGTCATCCTGGGTCAGTTGATGAGAAGAAGCTTTTCCTGATTGATCTT
GGTTTAGCATCCAGGTGGAAAGAAGCATCATCTGGTCAGCATGTTGACTATGATCAGAGG
CCAGATGTCTTTAGGGGAACAATTAGATACGCTAGCGTCCATGCCCACTTAGGTCGTACA
GGTAGCAGGAGGGATGATTTAGAGTCACTGGCTTACACCCTAATCTTTTTAATAAGAGGG
AGATTACCTTGGCAAGGGTATCAGGGAGATAACAAGAGTTTTCTTGTTTGTAAGAAGAAA
ATGGCTACTTCACCAGAGTTGCTGTGTTGCTTCTGTCCAGCTCCGTTCAAACATTTTCTA
GAGATGGTCACTAACATGAAATTTGACGAAGAGCCAAACTATCCAAAACTTATTTCTCTC
TTTGATGGTTTGATTGAAGGGCCTGCTTCAAGGCCCATCAGAATTGATGGAGCTCTGAAG
GTTGGGCAAAAACGTGGAAGAATGGTTGTAAATCTTGACGATGATGAACAGCCCAAGAAG
AAAGTTAGGTTGGGAAGCCCAGCAACTCAATGGATCTCAGTTTATAATGCTAGGCGGCCC
ATGAAGCAGAGATATCACTATAATGTTGCTGATTCAAGGCTGCATCAGCATATAGAAAAA
GGCAATGAAGATGGGCTGTACATTAGTTGTGTCTCTTCTTCCGCAAATTTTTGGGCTCTC
ATAATGGATGCTGGGACTGGCTTTTGTTCCCAAGTTTATGAGCTTTCACAAGTGTTTCTG
CACAAGGATTGGATTATGGAGCAGTGGGAGAAGAATTATTACATAACGGCAATAGCAGGA
GCAACCAATGGAAGCTCATTGGTTGTAATGTCCAAAGGAACTCCATACACACAGCAGTCA
TACAAAGTCAGTGAATCCTTTCCTTACAAGTGGATTAACAAAAAGTGGAAAGAAGGTTTC
CATGTGACATCTATGGCTACTGCTGGAAACCGTTGGGGAGTTGTCATGTCAAGAAATGCA
GGCTATTCCCATCAGGTGGTAGAGTTGGACTTTCTATATCCAAGTGAAGGGATCCATCGG
CGATGGGAGACAGGTTACAGAATAACTTCGACTGCAGCAACTCCTGACCAAGCTGCCTTC
ATCTTGAGCATACCAAAGAGGAAGCCAATGGACGAGACACAAGAAACTCTTCGAACTTCC
TCCTTTCCCAGCAACCATGTCAAGGAAAAATGGTCAAAGAACCTATACATCGCTTCAATC
TGCTACGGCCGGACCGTATGCTGA

Protein

708 aa

>Os03t0793500-01 Casein kinase I, Photoperiodic control of flowering time, Long-day repression
MPELRGGVWRARLRSKKVYDVQDADPAASPVSPAPRGRTGRRGGAAAGRGNKTVAEGGGR
KALKPRGKGCRAVDLCKDQPCKDLPEVIARKAVTGKAQEDLGLNKVADRAANLMMDGESG
DKFAAAEDESTTTPVPERVQVGNSPEYITDRKLGKGGFGQVYVGRRVSGGGSRTGPDAQE
VALKFEHRSSKGCNYGPPYEWQVYHTLNGCYGIPSVHYKGRLGDYYILVMDMLGPSLWDV
WNSVGQAMSAHMVACIAVEAISILEKLHSKGFVHGDVKPENFLLGHPGSVDEKKLFLIDL
GLASRWKEASSGQHVDYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIRG
RLPWQGYQGDNKSFLVCKKKMATSPELLCCFCPAPFKHFLEMVTNMKFDEEPNYPKLISL
FDGLIEGPASRPIRIDGALKVGQKRGRMVVNLDDDEQPKKKVRLGSPATQWISVYNARRP
MKQRYHYNVADSRLHQHIEKGNEDGLYISCVSSSANFWALIMDAGTGFCSQVYELSQVFL
HKDWIMEQWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGF
HVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAF
ILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC*

5'UTR

chr03:32999502..32999688 (+ strand) : 187 bp

chr03:33000382..33000434 (+ strand) : 53 bp

CDS

chr03:33000435..33000848 (+ strand) : 414 bp

chr03:33001510..33001635 (+ strand) : 126 bp

chr03:33001719..33001792 (+ strand) : 74 bp

chr03:33001882..33001951 (+ strand) : 70 bp

chr03:33002036..33002091 (+ strand) : 56 bp

chr03:33002176..33002247 (+ strand) : 72 bp

chr03:33002359..33002453 (+ strand) : 95 bp

chr03:33002610..33002676 (+ strand) : 67 bp

chr03:33002773..33002902 (+ strand) : 130 bp

chr03:33002992..33003207 (+ strand) : 216 bp

chr03:33003301..33003431 (+ strand) : 131 bp

chr03:33004133..33004307 (+ strand) : 175 bp

chr03:33004391..33004481 (+ strand) : 91 bp

chr03:33005565..33005722 (+ strand) : 158 bp

chr03:33006177..33006365 (+ strand) : 189 bp

chr03:33006480..33006539 (+ strand) : 60 bp

3'UTR

chr03:33006540..33006898 (+ strand) : 359 bp

FASTA

>Os03t0793500-01 class=Sequence position=chr03:32999502..33006898 (+ strand)
GCAGCAGCCG CAGCAGCAGC AAAGCCTCCC CCCCCAACCC ACCACCGCGA CACGCACGCG AGCGACGCGA GCGCTCCACG
ATTTCTCTGC CTCCCCCCCC CCCTCGGTCT CCTCCTCCCC CACCACCACC GCACGCTTCC CGAGGCGCCG CCCTCCGCCG
CCGCGGGCAT CCGCTTCCGA CGACGATGTA AGCCGCTCTT CTCCGCGCTC TCGCTCTGTG TTTTTTTTTT TTTTGGGGGG
GGGGGTTGAT CGGTGGGGGC GGTTGCTTGA GGCGCGATCG GATTGCGGGG CGGGGTCGCT GACGCTGGGG GGGGAGTGAT
CCGATGGGGT TGAGGAGGGC CGATTCGGGC GCTGGAAATG GGTTCGGTTT CGAGGATAGA TGCTTGCCTC ATGGGGAGCT
TTATTGCGGA TTTAGGAAAA AAAGCGTGGT TTGCGTGGGA TTGGGGGATT TGTGGCGGGT TGGGATTAGT TTAGGATTGG
TTTGGTGTTG GATTGGTGGT AATCTGGAGG TAAAAGGTGG GAGTTTTTTT TTTCCTTTCT GGGTGGAGAT CCCCTGCGGG
GTATCGGGTG ATGGAGATGC TCGGGCTTCT TTTAGAGCGC CGATGGCGGC ATTCGATTCC GTTGAAAGGG CAGTGGTGGT
AGCAAAGCGG GCTGCGTCTT TAAGGGGGGG GGGGGGGGGG CTCGCGATGG CGATGAATGC CTCAGATTGA TTCCACTCCG
ATCTTTTCCT ATTCCCGATT CATTGCTTGA TTGATTTGCC ATGACATGGT GAAGGAACAA TCTTTGAGCT GAAATTTGTT
TATGTTTGTG ATTGTTGTGC CTGCTGTGGT TTCCTTCATC AGTGATTTAT TCTTGTTGGA TGTTTTTTTT TCATGCGGAG
ATTGGAAGGA GCACCGAAGG GTGTAGCACA AGGCCGAGTT GCATGGGGCG ATAATGCCAG AGTTGCGGGG TGGTGTTTGG
AGAGCTCGTC TGAGGTCCAA GAAGGTTTAC GACGTCCAGG ACGCAGATCC AGCTGCGAGT CCGGTGTCGC CAGCTCCGCG
GGGGAGGACT GGAAGGCGCG GCGGTGCTGC GGCTGGCAGA GGCAACAAGA CAGTTGCTGA GGGAGGAGGG AGGAAAGCTC
TGAAGCCTAG AGGAAAGGGG TGCAGGGCTG TTGATTTGTG TAAGGATCAA CCTTGCAAGG ACCTCCCTGA AGTTATTGCT
AGAAAGGCGG TTACCGGCAA AGCCCAGGAG GACCTTGGTT TGAACAAGGT AGCTGACAGA GCTGCGAACT TGATGATGGA
CGGCGAAAGT GGAGACAAAT TTGCTGCGGC AGAAGATGAA TCCACTACAA CACCAGTTCC TGAGCGGGTA TGGAATACCT
TCTTCCCTTT GCACTTCTGT AGGTGTACTA TCATTTGTAC CGATAAAGTC ATTTTCTTCA AGTTCTTTAA CATGGGATGT
TTCATCATTT TTGTTTACTT TGTTTGGTAG TTTTTGTATG GTTGCTGTTC CAGATGTTCA TGTTACCTTT CACAGATGAC
TTCTCTGCTG TATTGGTGTT ATTAGACACA AGACAACCGA CATGTCTGTT TCACATAAAA TATAGTGTAA CCAAATTTAG
AAGTTATAAA GTATAATAAT TGATGATGAT TCATCTGAAT TGTGGCGTAA GAAATGGTTT AGTTGTTATG CTTGAGAGGT
GAGTGCCTAT TTGCTTGGCG AAGCTGAGAT TGAGGCACTG AATGGCTGGA TTATAGTAGT TTTGTTTTGT AGAGGAAACA
AACTTCAGAT AATCACATAG TATCACATCC TGATATCACA AAACCGATGA AACTCCGTGG CAAGTTCATC AAACAACAAA
GTTTAGGAAT GGGAAAGTTA CAATCTCTTG CTCTTTGACA TCAAATTTTA TCACTAAAAT AGGAGTTTGC TTCTCCTGGT
GACATCTTTT ATCTACACTT TATGTGGCAG AGTTTCACTG CCATTAATTA ACCTCCTAAA ATTCTAAATA GTTATATATG
TTTTACAGGT TCAAGTAGGC AATTCCCCAG AGTATATAAC TGATAGGAAG TTGGGTAAAG GTGGATTTGG TCAGGTCTAT
GTTGGTCGAA GAGTATCTGG TGGAGGTTCT CGCACGGGTC CAGATGCGCA AGAGGTTTCA TTTCTTACCA CCTCAATTGG
ACACTGAAGC TCTGTTAGTT TAGTTAGTTT TTAGATATCT GAATGAATAT CCTGTAGGTT GCGCTTAAAT TTGAGCACCG
AAGCAGTAAA GGATGTAACT ATGGCCCTCC ATACGAGTGG CAGGTTTACC AGTAAGAATT TCACACAATC TATCCCTTCT
GATGTTTATG TTGTTCTATG TGGAGTATGA TCCATTAACC TTTTGTCCTT TTGTAAATAG CACTCTCAAT GGTTGTTATG
GCATACCATC AGTCCACTAT AAGGGTCGTT TGGGAGACTA CTACATTCTT GTGCGTTTAC CTTAGTCATG TATTGAAAAA
TGTTTCTGGA CTCAAAATAA ATTATTTTAT TCAACCATCA CACCAAAATT TCAGGTAATG GATATGCTTG GTCCCAGCCT
CTGGGATGTG TGGAATTCAG TGGGACAGGC GTAAGTTTCG GATCACCTTT TTGCATTGAC CACCTGATTT TATTACTCCT
CACTGAAAAT AACAGCATTG GAACTTGCAA ACAGGATGTC TGCCCATATG GTTGCTTGCA TTGCTGTGGA AGCGATATCA
ATTCTTGAGA AGCTTCACTC TAAAGGGTAA AATTTAAAGT CACTTGTGCC TGAAAATTAT ATGGAGCTGC ATGGAATTTC
TCTTTTGTTT TCTATTTCAT TGGTGTTAAC ATTTCCAGTG CATCTTATCA TTGCCAGGTT TGTACATGGT GATGTCAAAC
CAGAGAATTT TTTGCTTGGT CATCCTGGGT CAGTTGATGA GAAGAAGCTT TTCCTGATTG ATCTTGGTTT AGGTAGGCTT
TTGTTCAAAG TAGTCTCATC TGTGTATGAA GTATTCAATT TAGTTCTCAA TGTGCTATGG CATTTGCTCT TATGCATTTT
GTACTTGAAT CCCAAGGAAT TGTTGCCCTG TTGATTTATT TTTATTTCGT GATGTTGAAA TCATGCAGCA TCCAGGTGGA
AAGAAGCATC ATCTGGTCAG CATGTTGACT ATGATCAGAG GCCAGATGTC TTTAGGTTCG TCCATTTTTG TGTGTGCACT
ATAATATCTT TTTCTCTGTA TTAAATTATG GGCAATTATT AACTTACCTT TTTCTTTTCG ACATTTTACA GGGGAACAAT
TAGATACGCT AGCGTCCATG CCCACTTAGG TCGTACAGGT AGCAGGAGGG ATGATTTAGA GTCACTGGCT TACACCCTAA
TCTTTTTAAT AAGAGGGAGA TTACCTTGGC AAGGGTATCA GGTAGCCTTT AATATGCTCA GCAAAGTTTT GACATAATGT
TTTCTTCTAT TTGTTGAACT TATTTTAGTG TTAATGGGAT GGTAATGCAG GGAGATAACA AGAGTTTTCT TGTTTGTAAG
AAGAAAATGG CTACTTCACC AGAGTTGCTG TGTTGCTTCT GTCCAGCTCC GTTCAAACAT TTTCTAGAGA TGGTCACTAA
CATGAAATTT GACGAAGAGC CAAACTATCC AAAACTTATT TCTCTCTTTG ATGGTTTGAT TGAAGGGCCT GCTTCAAGGC
CCATCAGAAT TGATGGAGCT CTGAAGGTAT GTAAATGTTG TACACACAAC CTGTGTCTGT ACCATACAGA TTAACTTGAA
TGCGTTAAAT TTTCTCATGT ATATTTTTGC ATATTATAGG TTGGGCAAAA ACGTGGAAGA ATGGTTGTAA ATCTTGACGA
TGATGAACAG CCCAAGAAGA AAGTTAGGTT GGGAAGCCCA GCAACTCAAT GGATCTCAGT TTATAATGCT AGGCGGCCCA
TGAAGCAGAG GTAATGCCCT AAAAACTGAA AATGGTGCAA AGTCTCTGTG TCTGTTATTT ATTTTCCCAA ACATTGTCCT
CGCAATGCAC TTGCCTTTAA GTGTGGACGC ACTTGCCTTT AAGTGTGGAC TGAGCACATA ACACGATGCT ATCCAGTTGC
CACCAGACAC TTTACAACTG GTCTGTTCTG TTTCCCTGAT GTCAGGATCT CATAAGGCTT CTTATCACTA TGATATTACG
CAAACTGCTT TTGAGTTATC TCCGATACAT TTTATTGTTC TAACTACATT TTATATGTCT CCAAATTTGC TGGGTTAAGC
AAGAGTTCAG TGACTAACTC TGTCTTGATT GATGTTGTCA CTGGGGATAG TTCCTGTATG CGCCTAGTGT CATCCATTTT
AGCATGGACT TAACTTTACC TGATTCCTGG CAAAAGCAGC GATGTGAAAA TATCATCCAT GGCGTTAGCT GAACCCTTCA
TGCTAGTTTT AGTGATGGAA GTGTTTGTGT GTGTGTGCGT GCCCCTGCAT GCCCATGCTT ATTACAATTT CAGCCTTCAT
AGCTCTTATT TCTTTGGCCT CCTTGTTCTA GAATTTGAGT TTTTGAAGTC AACCTAGTTC TCAGCTATTA ATCCATATAT
TTATCCTCTT TAAAAATTAA ATATGATATA TATTGACGTG GCTGCAAAAT GCATCACTTC TTTCTTTACA GATATCACTA
TAATGTTGCT GATTCAAGGC TGCATCAGCA TATAGAAAAA GGCAATGAAG ATGGGCTGTA CATTAGTTGT GTCTCTTCTT
CCGCAAATTT TTGGGCTCTC ATAATGGATG CTGGGACTGG CTTTTGTTCC CAAGTTTATG AGCTTTCACA AGTGTTTCTG
CACAAGGTGC ACTGGCTATT TCTCCACCCC TTCCATCCAG TTTTGATGAA TCCAGAGTCC TGACTCCATA TTACCTTGTT
TGTACATAGG ATTGGATTAT GGAGCAGTGG GAGAAGAATT ATTACATAAC GGCAATAGCA GGAGCAACCA ATGGAAGCTC
ATTGGTTGTA ATGTCCAAAG GTTGGTAAAA TACCTTTTCT CTGCTGGCAA ACTAATTTTA CTACCTTGGC TATTTCTTAG
AACTTGAAAC AACCCCGTTG ATGAATATGA AATAGTTGAA ACAGTCAGTT GCTTTAAGAC AGTTTTCAGC AGAACCTCTT
GTGCAGCAAG GGTATGTGCC TTGCATACTA GACTGATTGA AACATGAGTG TGTTGAAGGC ATAACCTGCA ACAACTTCAT
AGGTTAAAAT GATTTGTGTA GACTGTAGAG TGTGATCCTT TTTATTTGGG GGGACAGCCA CCAGTATTGC CTGCTCAATT
GCTCGGCAAG TAGCAATAAT TTTCGTTTCA TTGTGTAAAG GACGAACAAT CAGATGGTTC CTGTTAAAAC TGTGATGGTT
AACAGTAGGT TTGTAAGTAG GCATTTCGTC CATGCTCTCA TCAGTCCATG GCAGCTTGAG GCAGAATTTA TTTAGAGGGT
GCCACAAGTT CATAACATGA ATGGCAGACA GACATACATA ATCTGTCTCT ATAATACACA AATATCTATG AACTAATATT
TGGTTTGGCC AGTTTTGATC AAAAAGTTGA TGGATCAATT TTGTTACCAG TTTTCCTTTG CTTCAACACT TAAATTTAAg
agtaaatttc acaaaactac agatatattg accaaactat cacaaaactg cagatttaac accaaattta tcacaaaact
acaggtctaa ggtggagtct cacaaaactt tagatttagt aacaaagttt tcacaaaact acaggtttag cgtcaattta
atcacaaaac ttggacgttt tatgactcaa acataacatt agtgctaagg atttaaaccc caaaaattgt agttttgtga
taattttata aatgtgtagt tttgtggtac ttagccttag acctgtaacc ttaaatctgt agttttgcat taatttggtc
aaagtatctg tacttttgtg aaatttACTC TTTAATTTTG TATTTCTACT CTCAACTGTC TGGACTCCAA TTTTTCCTGT
GAGCTTCTGG TGTCCTTCCA TTAGATACTA TCGTTCTAAA CCAGGCATGT ATCATCATTA CAGGAACTCC ATACACACAG
CAGTCATACA AAGTCAGTGA ATCCTTTCCT TACAAGTGGA TTAACAAAAA GTGGAAAGAA GGTTTCCATG TGACATCTAT
GGCTACTGCT GGAAACCGTT GGGGAGTTGT CATGTCAAGA AATGCAGGCT ATTCCCATCA GGTTAAAAGA TTTCGATTTA
CCAATCCTTG TGTTCATTCT TTCTATGAAT TTGGTGGCTT CTCATATGCC AAATAACCTG TACGTGATAA AAAATGGTAT
ATACACCTTG ATTGGTAAAG AATATCCAAC GATAAGTTAC TGTCGATAGG CTAACCTCAA AACCATCAGT TTAAGTGTTG
CGTGCGGAAA CTACCTAACT CCAAACTTTT GTTGCTGTAA GGATGTCATC TTGTTTGTGG TTGAATTCGA ACATTCAACT
GGTAGAATGC TTGATGTACC AATCAGTTGA GTTTGTGCTC TTTACAGCTG TTAACCAAAA AAGCAGGGAA ATACAGTAAC
CACACATGTT TCTATTCTGA ATTTTCTTAC ATATTATCTT GATGTTCAGA CTCCTGAGTT GATCACTGCT TCATAGTGAG
TAAGTCTGAA ACTGAATCCG TCTCGCAATG TGCAGGTGGT AGAGTTGGAC TTTCTATATC CAAGTGAAGG GATCCATCGG
CGATGGGAGA CAGGTTACAG AATAACTTCG ACTGCAGCAA CTCCTGACCA AGCTGCCTTC ATCTTGAGCA TACCAAAGAG
GAAGCCAATG GACGAGACAC AAGAAACTCT TCGAACTTCC TCCTTTCCCA GCAACCATGT CAAGGTACAT ACATCTTCAG
CTCTCCCAAC CTCACAATGC CATACAAAAT CTTATGATGC GTCGAACTTT TTTTGACGGA AATGATGCGT CGAACTAACA
TTGCTGTTAA AATCTCAGGA AAAATGGTCA AAGAACCTAT ACATCGCTTC AATCTGCTAC GGCCGGACCG TATGCTGACA
GCTTCAACAT TTCGAAGCTC CAATGTGAAG CCATGTCTAG CTACTACTAG CATTTTGCAG TGAGCTGCCA ACCGATCAAA
TCTCCCTTGA TTGGGAGATC TGAAGCAAGG AAAAAAAAAA GAAACAAATC AATGGCTGAC ATCACCGGCC TCTTGCAGCC
ATCTATTCTA ACTGTAAAAA TTGAAAAAAA AAATCATGGC AAATGTTGTA CCAGATCGGA TATGGAGACC TTTGTCCATA
AGCTAAGCTA GTATAAGCTG CATGGCGGTG CTAAGATCAT ATTGTTCTCA CATACGGAGT ATATATATAT CATACTACTC
TCTCTgtttc agattataag atattttgac tttggcc