Os03t0793500-02

Locus

Os03g0793500

Description

Similar to Casein kinase-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HD16

CGSNL Gene Name

HEADING DATE 16

Oryzabase Gene Symbol Synonym(s)

Hd16, EL1, CK1, Hd16/CKI, Hd16/EL1

Oryzabase Gene Name Synonym(s)

EARLY FLOWERING 1, Early flowering1, Casein Kinase I

Transcript Evidence

AK103407 (DDBJ, Best hit)

Protein Evidence

B6U8U2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

J033128D14 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0793500-02)

Others

Oryzabase (8704)

KEGG (Os03t0793500-02)

Transcript

2422 bp

>Os03t0793500-02 Similar to Casein kinase-like protein.
CACGCGAGCGACGCGAGCGCTCCACGATTTCTCTGCCTCCCCCCCCCCCTCGGTCTCCTC
CTCCCCCACCACCACCGCACGCTTCCCGAGGCGCCGCCCTCCGCCGCCGCGGGCATCCGC
TTCCGACGACGATATTGGAAGGAGCACCGAAGGGTGTAGCACAAGGCCGAGTTGCATGGG
GCGATAATGCCAGAGTTGCGGGGTGGTGTTTGGAGAGCTCGTCTGAGGTCCAAGAAGGTT
TACGACGTCCAGGACGCAGATCCAGCTGCGAGTCCGGTGTCGCCAGCTCCGCGGGGGAGG
ACTGGAAGGCGCGGCGGTGCTGCGGCTGGCAGAGGCAACAAGACAGTTGCTGAGGGAGGA
GGGAGGAAAGCTCTGAAGCCTAGAGGAAAGGGGTGCAGGGCTGTTGATTTGTGTAAGGAT
CAACCTTGCAAGGACCTCCCTGAAGTTATTGCTAGAAAGGCGGTTACCGGCAAAGCCCAG
GAGGACCTTGGTTTGAACAAGGTAGCTGACAGAGCTGCGAACTTGATGATGGACGGCGAA
AGTGGAGACAAATTTGCTGCGGCAGAAGATGAATCCACTACAACACCAGTTCCTGAGCGG
GTTCAAGTAGGCAATTCCCCAGAGTATATAACTGATAGGAAGTTGGGTAAAGGTGGATTT
GGTCAGGTCTATGTTGGTCGAAGAGTATCTGGTGGAGGTTCTCGCACGGGTCCAGATGCG
CAAGAGGTTGCGCTTAAATTTGAGCACCGAAGCAGTAAAGGATGTAACTATGGCCCTCCA
TACGAGTGGCAGGTTTACCACACTCTCAATGGTTGTTATGGCATACCATCAGTCCACTAT
AAGGGTCGTTTGGGAGACTACTACATTCTTGTAATGGATATGCTTGGTCCCAGCCTCTGG
GATGTGTGGAATTCAGTGGGACAGGCGATGTCTGCCCATATGGTTGCTTGCATTGCTGTG
GAAGCGATATCAATTCTTGAGAAGCTTCACTCTAAAGGGTTTGTACATGGTGATGTCAAA
CCAGAGAATTTTTTGCTTGGTCATCCTGGGTCAGTTGATGAGAAGAAGCTTTTCCTGATT
GATCTTGGTTTAGCATCCAGGTGGAAAGAAGCATCATCTGGTCAGCATGTTGACTATGAT
CAGAGGCCAGATGTCTTTAGGGGAACAATTAGATACGCTAGCGTCCATGCCCACTTAGGT
CGTACAGGTAGCAGGAGGGATGATTTAGAGTCACTGGCTTACACCCTAATCTTTTTAATA
AGAGGGAGATTACCTTGGCAAGGGTATCAGGGAGATAACAAGAGTTTTCTTGTTTGTAAG
AAGAAAATGGCTACTTCACCAGAGTTGCTGTGTTGCTTCTGTCCAGCTCCGTTCAAACAT
TTTCTAGAGATGGTCACTAACATGAAATTTGACGAAGAGCCAAACTATCCAAAACTTATT
TCTCTCTTTGATGGTTTGATTGAAGGGCCTGCTTCAAGGCCCATCAGAATTGATGGAGCT
CTGAAGGTTGGGCAAAAACGTGGAAGAATGGTTGTAAATCTTGACGATGATGAACAGCCC
AAGAAGAAAGTTAGGTTGGGAAGCCCAGCAACTCAATGGATCTCAGTTTATAATGCTAGG
CGGCCCATGAAGCAGAGATATCACTATAATGTTGCTGATTCAAGGCTGCATCAGCATATA
GAAAAAGGCAATGAAGATGGGCTGTACATTAGTTGTGTCTCTTCTTCCGCAAATTTTTGG
GCTCTCATAATGGATGCTGGGACTGGCTTTTGTTCCCAAGTTTATGAGCTTTCACAAGTG
TTTCTGCACAAGGATTGGATTATGGAGCAGTGGGAGAAGAATTATTACATAACGGCAATA
GCAGGAGCAACCAATGGAAGCTCATTGGTTGTAATGTCCAAAGGAACTCCATACACACAG
CAGTCATACAAAGTCAGTGAATCCTTTCCTTACAAGTGGATTAACAAAAAGTGGAAAGAA
GGTTTCCATGTGACATCTATGGCTACTGCTGGAAACCGTTGGGGAGTTGTCATGTCAAGA
AATGCAGGCTATTCCCATCAGGTGGTAGAGTTGGACTTTCTATATCCAAGTGAAGGGATC
CATCGGCGATGGGAGACAGGTTACAGAATAACTTCGACTGCAGCAACTCCTGACCAAGCT
GCCTTCATCTTGAGCATACCAAAGAGGAAGCCAATGGACGAGACACAAGAAACTCTTCGA
ACTTCCTCCTTTCCCAGCAACCATGTCAAGGAAAAATGGTCAAAGAACCTATACATCGCT
TCAATCTGCTACGGCCGGACCGTATGCTGACAGCTTCAACATTTCGAAGCTCCAATGTGA
AGCCATGTCTAGCTACTACTAGCATTTTGCAGTGAGCTGCCAACCGATCAAATCTCCCTT
GATTGGGAGATCTGAAGCAAGG

CDS

2124 bp

>Os03t0793500-02 Similar to Casein kinase-like protein.
ATGCCAGAGTTGCGGGGTGGTGTTTGGAGAGCTCGTCTGAGGTCCAAGAAGGTTTACGAC
GTCCAGGACGCAGATCCAGCTGCGAGTCCGGTGTCGCCAGCTCCGCGGGGGAGGACTGGA
AGGCGCGGCGGTGCTGCGGCTGGCAGAGGCAACAAGACAGTTGCTGAGGGAGGAGGGAGG
AAAGCTCTGAAGCCTAGAGGAAAGGGGTGCAGGGCTGTTGATTTGTGTAAGGATCAACCT
TGCAAGGACCTCCCTGAAGTTATTGCTAGAAAGGCGGTTACCGGCAAAGCCCAGGAGGAC
CTTGGTTTGAACAAGGTAGCTGACAGAGCTGCGAACTTGATGATGGACGGCGAAAGTGGA
GACAAATTTGCTGCGGCAGAAGATGAATCCACTACAACACCAGTTCCTGAGCGGGTTCAA
GTAGGCAATTCCCCAGAGTATATAACTGATAGGAAGTTGGGTAAAGGTGGATTTGGTCAG
GTCTATGTTGGTCGAAGAGTATCTGGTGGAGGTTCTCGCACGGGTCCAGATGCGCAAGAG
GTTGCGCTTAAATTTGAGCACCGAAGCAGTAAAGGATGTAACTATGGCCCTCCATACGAG
TGGCAGGTTTACCACACTCTCAATGGTTGTTATGGCATACCATCAGTCCACTATAAGGGT
CGTTTGGGAGACTACTACATTCTTGTAATGGATATGCTTGGTCCCAGCCTCTGGGATGTG
TGGAATTCAGTGGGACAGGCGATGTCTGCCCATATGGTTGCTTGCATTGCTGTGGAAGCG
ATATCAATTCTTGAGAAGCTTCACTCTAAAGGGTTTGTACATGGTGATGTCAAACCAGAG
AATTTTTTGCTTGGTCATCCTGGGTCAGTTGATGAGAAGAAGCTTTTCCTGATTGATCTT
GGTTTAGCATCCAGGTGGAAAGAAGCATCATCTGGTCAGCATGTTGACTATGATCAGAGG
CCAGATGTCTTTAGGGGAACAATTAGATACGCTAGCGTCCATGCCCACTTAGGTCGTACA
GGTAGCAGGAGGGATGATTTAGAGTCACTGGCTTACACCCTAATCTTTTTAATAAGAGGG
AGATTACCTTGGCAAGGGTATCAGGGAGATAACAAGAGTTTTCTTGTTTGTAAGAAGAAA
ATGGCTACTTCACCAGAGTTGCTGTGTTGCTTCTGTCCAGCTCCGTTCAAACATTTTCTA
GAGATGGTCACTAACATGAAATTTGACGAAGAGCCAAACTATCCAAAACTTATTTCTCTC
TTTGATGGTTTGATTGAAGGGCCTGCTTCAAGGCCCATCAGAATTGATGGAGCTCTGAAG
GTTGGGCAAAAACGTGGAAGAATGGTTGTAAATCTTGACGATGATGAACAGCCCAAGAAG
AAAGTTAGGTTGGGAAGCCCAGCAACTCAATGGATCTCAGTTTATAATGCTAGGCGGCCC
ATGAAGCAGAGATATCACTATAATGTTGCTGATTCAAGGCTGCATCAGCATATAGAAAAA
GGCAATGAAGATGGGCTGTACATTAGTTGTGTCTCTTCTTCCGCAAATTTTTGGGCTCTC
ATAATGGATGCTGGGACTGGCTTTTGTTCCCAAGTTTATGAGCTTTCACAAGTGTTTCTG
CACAAGGATTGGATTATGGAGCAGTGGGAGAAGAATTATTACATAACGGCAATAGCAGGA
GCAACCAATGGAAGCTCATTGGTTGTAATGTCCAAAGGAACTCCATACACACAGCAGTCA
TACAAAGTCAGTGAATCCTTTCCTTACAAGTGGATTAACAAAAAGTGGAAAGAAGGTTTC
CATGTGACATCTATGGCTACTGCTGGAAACCGTTGGGGAGTTGTCATGTCAAGAAATGCA
GGCTATTCCCATCAGGTGGTAGAGTTGGACTTTCTATATCCAAGTGAAGGGATCCATCGG
CGATGGGAGACAGGTTACAGAATAACTTCGACTGCAGCAACTCCTGACCAAGCTGCCTTC
ATCTTGAGCATACCAAAGAGGAAGCCAATGGACGAGACACAAGAAACTCTTCGAACTTCC
TCCTTTCCCAGCAACCATGTCAAGGAAAAATGGTCAAAGAACCTATACATCGCTTCAATC
TGCTACGGCCGGACCGTATGCTGA

Protein

708 aa

>Os03t0793500-02 Similar to Casein kinase-like protein.
MPELRGGVWRARLRSKKVYDVQDADPAASPVSPAPRGRTGRRGGAAAGRGNKTVAEGGGR
KALKPRGKGCRAVDLCKDQPCKDLPEVIARKAVTGKAQEDLGLNKVADRAANLMMDGESG
DKFAAAEDESTTTPVPERVQVGNSPEYITDRKLGKGGFGQVYVGRRVSGGGSRTGPDAQE
VALKFEHRSSKGCNYGPPYEWQVYHTLNGCYGIPSVHYKGRLGDYYILVMDMLGPSLWDV
WNSVGQAMSAHMVACIAVEAISILEKLHSKGFVHGDVKPENFLLGHPGSVDEKKLFLIDL
GLASRWKEASSGQHVDYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIRG
RLPWQGYQGDNKSFLVCKKKMATSPELLCCFCPAPFKHFLEMVTNMKFDEEPNYPKLISL
FDGLIEGPASRPIRIDGALKVGQKRGRMVVNLDDDEQPKKKVRLGSPATQWISVYNARRP
MKQRYHYNVADSRLHQHIEKGNEDGLYISCVSSSANFWALIMDAGTGFCSQVYELSQVFL
HKDWIMEQWEKNYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGF
HVTSMATAGNRWGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAF
ILSIPKRKPMDETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC*

5'UTR

chr03:32999556..32999688 (+ strand) : 133 bp

chr03:33000382..33000434 (+ strand) : 53 bp

CDS

chr03:33000435..33000848 (+ strand) : 414 bp

chr03:33001510..33001635 (+ strand) : 126 bp

chr03:33001719..33001792 (+ strand) : 74 bp

chr03:33001882..33001951 (+ strand) : 70 bp

chr03:33002036..33002091 (+ strand) : 56 bp

chr03:33002176..33002247 (+ strand) : 72 bp

chr03:33002359..33002453 (+ strand) : 95 bp

chr03:33002610..33002676 (+ strand) : 67 bp

chr03:33002773..33002902 (+ strand) : 130 bp

chr03:33002992..33003207 (+ strand) : 216 bp

chr03:33003301..33003431 (+ strand) : 131 bp

chr03:33004133..33004307 (+ strand) : 175 bp

chr03:33004391..33004481 (+ strand) : 91 bp

chr03:33005565..33005722 (+ strand) : 158 bp

chr03:33006177..33006365 (+ strand) : 189 bp

chr03:33006480..33006539 (+ strand) : 60 bp

3'UTR

chr03:33006540..33006651 (+ strand) : 112 bp

FASTA

>Os03t0793500-02 class=Sequence position=chr03:32999556..33006651 (+ strand)
CACGCGAGCG ACGCGAGCGC TCCACGATTT CTCTGCCTCC CCCCCCCCCT CGGTCTCCTC CTCCCCCACC ACCACCGCAC
GCTTCCCGAG GCGCCGCCCT CCGCCGCCGC GGGCATCCGC TTCCGACGAC GATGTAAGCC GCTCTTCTCC GCGCTCTCGC
TCTGTGTTTT TTTTTTTTTT GGGGGGGGGG GTTGATCGGT GGGGGCGGTT GCTTGAGGCG CGATCGGATT GCGGGGCGGG
GTCGCTGACG CTGGGGGGGG AGTGATCCGA TGGGGTTGAG GAGGGCCGAT TCGGGCGCTG GAAATGGGTT CGGTTTCGAG
GATAGATGCT TGCCTCATGG GGAGCTTTAT TGCGGATTTA GGAAAAAAAG CGTGGTTTGC GTGGGATTGG GGGATTTGTG
GCGGGTTGGG ATTAGTTTAG GATTGGTTTG GTGTTGGATT GGTGGTAATC TGGAGGTAAA AGGTGGGAGT TTTTTTTTTC
CTTTCTGGGT GGAGATCCCC TGCGGGGTAT CGGGTGATGG AGATGCTCGG GCTTCTTTTA GAGCGCCGAT GGCGGCATTC
GATTCCGTTG AAAGGGCAGT GGTGGTAGCA AAGCGGGCTG CGTCTTTAAG GGGGGGGGGG GGGGGGCTCG CGATGGCGAT
GAATGCCTCA GATTGATTCC ACTCCGATCT TTTCCTATTC CCGATTCATT GCTTGATTGA TTTGCCATGA CATGGTGAAG
GAACAATCTT TGAGCTGAAA TTTGTTTATG TTTGTGATTG TTGTGCCTGC TGTGGTTTCC TTCATCAGTG ATTTATTCTT
GTTGGATGTT TTTTTTTCAT GCGGAGATTG GAAGGAGCAC CGAAGGGTGT AGCACAAGGC CGAGTTGCAT GGGGCGATAA
TGCCAGAGTT GCGGGGTGGT GTTTGGAGAG CTCGTCTGAG GTCCAAGAAG GTTTACGACG TCCAGGACGC AGATCCAGCT
GCGAGTCCGG TGTCGCCAGC TCCGCGGGGG AGGACTGGAA GGCGCGGCGG TGCTGCGGCT GGCAGAGGCA ACAAGACAGT
TGCTGAGGGA GGAGGGAGGA AAGCTCTGAA GCCTAGAGGA AAGGGGTGCA GGGCTGTTGA TTTGTGTAAG GATCAACCTT
GCAAGGACCT CCCTGAAGTT ATTGCTAGAA AGGCGGTTAC CGGCAAAGCC CAGGAGGACC TTGGTTTGAA CAAGGTAGCT
GACAGAGCTG CGAACTTGAT GATGGACGGC GAAAGTGGAG ACAAATTTGC TGCGGCAGAA GATGAATCCA CTACAACACC
AGTTCCTGAG CGGGTATGGA ATACCTTCTT CCCTTTGCAC TTCTGTAGGT GTACTATCAT TTGTACCGAT AAAGTCATTT
TCTTCAAGTT CTTTAACATG GGATGTTTCA TCATTTTTGT TTACTTTGTT TGGTAGTTTT TGTATGGTTG CTGTTCCAGA
TGTTCATGTT ACCTTTCACA GATGACTTCT CTGCTGTATT GGTGTTATTA GACACAAGAC AACCGACATG TCTGTTTCAC
ATAAAATATA GTGTAACCAA ATTTAGAAGT TATAAAGTAT AATAATTGAT GATGATTCAT CTGAATTGTG GCGTAAGAAA
TGGTTTAGTT GTTATGCTTG AGAGGTGAGT GCCTATTTGC TTGGCGAAGC TGAGATTGAG GCACTGAATG GCTGGATTAT
AGTAGTTTTG TTTTGTAGAG GAAACAAACT TCAGATAATC ACATAGTATC ACATCCTGAT ATCACAAAAC CGATGAAACT
CCGTGGCAAG TTCATCAAAC AACAAAGTTT AGGAATGGGA AAGTTACAAT CTCTTGCTCT TTGACATCAA ATTTTATCAC
TAAAATAGGA GTTTGCTTCT CCTGGTGACA TCTTTTATCT ACACTTTATG TGGCAGAGTT TCACTGCCAT TAATTAACCT
CCTAAAATTC TAAATAGTTA TATATGTTTT ACAGGTTCAA GTAGGCAATT CCCCAGAGTA TATAACTGAT AGGAAGTTGG
GTAAAGGTGG ATTTGGTCAG GTCTATGTTG GTCGAAGAGT ATCTGGTGGA GGTTCTCGCA CGGGTCCAGA TGCGCAAGAG
GTTTCATTTC TTACCACCTC AATTGGACAC TGAAGCTCTG TTAGTTTAGT TAGTTTTTAG ATATCTGAAT GAATATCCTG
TAGGTTGCGC TTAAATTTGA GCACCGAAGC AGTAAAGGAT GTAACTATGG CCCTCCATAC GAGTGGCAGG TTTACCAGTA
AGAATTTCAC ACAATCTATC CCTTCTGATG TTTATGTTGT TCTATGTGGA GTATGATCCA TTAACCTTTT GTCCTTTTGT
AAATAGCACT CTCAATGGTT GTTATGGCAT ACCATCAGTC CACTATAAGG GTCGTTTGGG AGACTACTAC ATTCTTGTGC
GTTTACCTTA GTCATGTATT GAAAAATGTT TCTGGACTCA AAATAAATTA TTTTATTCAA CCATCACACC AAAATTTCAG
GTAATGGATA TGCTTGGTCC CAGCCTCTGG GATGTGTGGA ATTCAGTGGG ACAGGCGTAA GTTTCGGATC ACCTTTTTGC
ATTGACCACC TGATTTTATT ACTCCTCACT GAAAATAACA GCATTGGAAC TTGCAAACAG GATGTCTGCC CATATGGTTG
CTTGCATTGC TGTGGAAGCG ATATCAATTC TTGAGAAGCT TCACTCTAAA GGGTAAAATT TAAAGTCACT TGTGCCTGAA
AATTATATGG AGCTGCATGG AATTTCTCTT TTGTTTTCTA TTTCATTGGT GTTAACATTT CCAGTGCATC TTATCATTGC
CAGGTTTGTA CATGGTGATG TCAAACCAGA GAATTTTTTG CTTGGTCATC CTGGGTCAGT TGATGAGAAG AAGCTTTTCC
TGATTGATCT TGGTTTAGGT AGGCTTTTGT TCAAAGTAGT CTCATCTGTG TATGAAGTAT TCAATTTAGT TCTCAATGTG
CTATGGCATT TGCTCTTATG CATTTTGTAC TTGAATCCCA AGGAATTGTT GCCCTGTTGA TTTATTTTTA TTTCGTGATG
TTGAAATCAT GCAGCATCCA GGTGGAAAGA AGCATCATCT GGTCAGCATG TTGACTATGA TCAGAGGCCA GATGTCTTTA
GGTTCGTCCA TTTTTGTGTG TGCACTATAA TATCTTTTTC TCTGTATTAA ATTATGGGCA ATTATTAACT TACCTTTTTC
TTTTCGACAT TTTACAGGGG AACAATTAGA TACGCTAGCG TCCATGCCCA CTTAGGTCGT ACAGGTAGCA GGAGGGATGA
TTTAGAGTCA CTGGCTTACA CCCTAATCTT TTTAATAAGA GGGAGATTAC CTTGGCAAGG GTATCAGGTA GCCTTTAATA
TGCTCAGCAA AGTTTTGACA TAATGTTTTC TTCTATTTGT TGAACTTATT TTAGTGTTAA TGGGATGGTA ATGCAGGGAG
ATAACAAGAG TTTTCTTGTT TGTAAGAAGA AAATGGCTAC TTCACCAGAG TTGCTGTGTT GCTTCTGTCC AGCTCCGTTC
AAACATTTTC TAGAGATGGT CACTAACATG AAATTTGACG AAGAGCCAAA CTATCCAAAA CTTATTTCTC TCTTTGATGG
TTTGATTGAA GGGCCTGCTT CAAGGCCCAT CAGAATTGAT GGAGCTCTGA AGGTATGTAA ATGTTGTACA CACAACCTGT
GTCTGTACCA TACAGATTAA CTTGAATGCG TTAAATTTTC TCATGTATAT TTTTGCATAT TATAGGTTGG GCAAAAACGT
GGAAGAATGG TTGTAAATCT TGACGATGAT GAACAGCCCA AGAAGAAAGT TAGGTTGGGA AGCCCAGCAA CTCAATGGAT
CTCAGTTTAT AATGCTAGGC GGCCCATGAA GCAGAGGTAA TGCCCTAAAA ACTGAAAATG GTGCAAAGTC TCTGTGTCTG
TTATTTATTT TCCCAAACAT TGTCCTCGCA ATGCACTTGC CTTTAAGTGT GGACGCACTT GCCTTTAAGT GTGGACTGAG
CACATAACAC GATGCTATCC AGTTGCCACC AGACACTTTA CAACTGGTCT GTTCTGTTTC CCTGATGTCA GGATCTCATA
AGGCTTCTTA TCACTATGAT ATTACGCAAA CTGCTTTTGA GTTATCTCCG ATACATTTTA TTGTTCTAAC TACATTTTAT
ATGTCTCCAA ATTTGCTGGG TTAAGCAAGA GTTCAGTGAC TAACTCTGTC TTGATTGATG TTGTCACTGG GGATAGTTCC
TGTATGCGCC TAGTGTCATC CATTTTAGCA TGGACTTAAC TTTACCTGAT TCCTGGCAAA AGCAGCGATG TGAAAATATC
ATCCATGGCG TTAGCTGAAC CCTTCATGCT AGTTTTAGTG ATGGAAGTGT TTGTGTGTGT GTGCGTGCCC CTGCATGCCC
ATGCTTATTA CAATTTCAGC CTTCATAGCT CTTATTTCTT TGGCCTCCTT GTTCTAGAAT TTGAGTTTTT GAAGTCAACC
TAGTTCTCAG CTATTAATCC ATATATTTAT CCTCTTTAAA AATTAAATAT GATATATATT GACGTGGCTG CAAAATGCAT
CACTTCTTTC TTTACAGATA TCACTATAAT GTTGCTGATT CAAGGCTGCA TCAGCATATA GAAAAAGGCA ATGAAGATGG
GCTGTACATT AGTTGTGTCT CTTCTTCCGC AAATTTTTGG GCTCTCATAA TGGATGCTGG GACTGGCTTT TGTTCCCAAG
TTTATGAGCT TTCACAAGTG TTTCTGCACA AGGTGCACTG GCTATTTCTC CACCCCTTCC ATCCAGTTTT GATGAATCCA
GAGTCCTGAC TCCATATTAC CTTGTTTGTA CATAGGATTG GATTATGGAG CAGTGGGAGA AGAATTATTA CATAACGGCA
ATAGCAGGAG CAACCAATGG AAGCTCATTG GTTGTAATGT CCAAAGGTTG GTAAAATACC TTTTCTCTGC TGGCAAACTA
ATTTTACTAC CTTGGCTATT TCTTAGAACT TGAAACAACC CCGTTGATGA ATATGAAATA GTTGAAACAG TCAGTTGCTT
TAAGACAGTT TTCAGCAGAA CCTCTTGTGC AGCAAGGGTA TGTGCCTTGC ATACTAGACT GATTGAAACA TGAGTGTGTT
GAAGGCATAA CCTGCAACAA CTTCATAGGT TAAAATGATT TGTGTAGACT GTAGAGTGTG ATCCTTTTTA TTTGGGGGGA
CAGCCACCAG TATTGCCTGC TCAATTGCTC GGCAAGTAGC AATAATTTTC GTTTCATTGT GTAAAGGACG AACAATCAGA
TGGTTCCTGT TAAAACTGTG ATGGTTAACA GTAGGTTTGT AAGTAGGCAT TTCGTCCATG CTCTCATCAG TCCATGGCAG
CTTGAGGCAG AATTTATTTA GAGGGTGCCA CAAGTTCATA ACATGAATGG CAGACAGACA TACATAATCT GTCTCTATAA
TACACAAATA TCTATGAACT AATATTTGGT TTGGCCAGTT TTGATCAAAA AGTTGATGGA TCAATTTTGT TACCAGTTTT
CCTTTGCTTC AACACTTAAA TTTAAgagta aatttcacaa aactacagat atattgacca aactatcaca aaactgcaga
tttaacacca aatttatcac aaaactacag gtctaaggtg gagtctcaca aaactttaga tttagtaaca aagttttcac
aaaactacag gtttagcgtc aatttaatca caaaacttgg acgttttatg actcaaacat aacattagtg ctaaggattt
aaaccccaaa aattgtagtt ttgtgataat tttataaatg tgtagttttg tggtacttag ccttagacct gtaaccttaa
atctgtagtt ttgcattaat ttggtcaaag tatctgtact tttgtgaaat ttACTCTTTA ATTTTGTATT TCTACTCTCA
ACTGTCTGGA CTCCAATTTT TCCTGTGAGC TTCTGGTGTC CTTCCATTAG ATACTATCGT TCTAAACCAG GCATGTATCA
TCATTACAGG AACTCCATAC ACACAGCAGT CATACAAAGT CAGTGAATCC TTTCCTTACA AGTGGATTAA CAAAAAGTGG
AAAGAAGGTT TCCATGTGAC ATCTATGGCT ACTGCTGGAA ACCGTTGGGG AGTTGTCATG TCAAGAAATG CAGGCTATTC
CCATCAGGTT AAAAGATTTC GATTTACCAA TCCTTGTGTT CATTCTTTCT ATGAATTTGG TGGCTTCTCA TATGCCAAAT
AACCTGTACG TGATAAAAAA TGGTATATAC ACCTTGATTG GTAAAGAATA TCCAACGATA AGTTACTGTC GATAGGCTAA
CCTCAAAACC ATCAGTTTAA GTGTTGCGTG CGGAAACTAC CTAACTCCAA ACTTTTGTTG CTGTAAGGAT GTCATCTTGT
TTGTGGTTGA ATTCGAACAT TCAACTGGTA GAATGCTTGA TGTACCAATC AGTTGAGTTT GTGCTCTTTA CAGCTGTTAA
CCAAAAAAGC AGGGAAATAC AGTAACCACA CATGTTTCTA TTCTGAATTT TCTTACATAT TATCTTGATG TTCAGACTCC
TGAGTTGATC ACTGCTTCAT AGTGAGTAAG TCTGAAACTG AATCCGTCTC GCAATGTGCA GGTGGTAGAG TTGGACTTTC
TATATCCAAG TGAAGGGATC CATCGGCGAT GGGAGACAGG TTACAGAATA ACTTCGACTG CAGCAACTCC TGACCAAGCT
GCCTTCATCT TGAGCATACC AAAGAGGAAG CCAATGGACG AGACACAAGA AACTCTTCGA ACTTCCTCCT TTCCCAGCAA
CCATGTCAAG GTACATACAT CTTCAGCTCT CCCAACCTCA CAATGCCATA CAAAATCTTA TGATGCGTCG AACTTTTTTT
GACGGAAATG ATGCGTCGAA CTAACATTGC TGTTAAAATC TCAGGAAAAA TGGTCAAAGA ACCTATACAT CGCTTCAATC
TGCTACGGCC GGACCGTATG CTGACAGCTT CAACATTTCG AAGCTCCAAT GTGAAGCCAT GTCTAGCTAC TACTAGCATT
TTGCAGTGAG CTGCCAACCG ATCAAATCTC CCTTGATTGG GAGATCTGAA GCAAGG