Os03t0797800-01

Locus

Os03g0797800

Description

AUX/IAA protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA14

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA14, AUX/IAA14, OsAUX/IAA14

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 14

Transcript Evidence

AK059619 (DDBJ, Best hit)

Protein Evidence

Q7Y1H8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

001-030-G11 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0797800-01)

RiceXPro (AK059619)

Others

Oryzabase (10903)

KEGG (Os03t0797800-01)

Transcript

1129 bp

>Os03t0797800-01 AUX/IAA protein family protein.
GACGACGAGGTCAGTGTCGCAGCGACGAACGCCGACGAGCTAGCTCTCTCTCTCGATCGA
TGGCCATGGCGGCGGAGAGCATCGACGCGGAGCTGCGCCTCGGGCTGCCCGGCAGCGGCG
GCGGTGACGGCGTGGCGGCGAAGAAGCGGCGGTCGGCGTCGTCGACGGTGAAGAGCGAGG
CCTCCGGCACGGCCTGCTGCGGCGGCGCCGGCGCCCGGGACGTCGAAGACGGCGCCTCGC
CGGCGTCCAAAGTGCAGGTGGTGGGGTGGCCGCCGGTGGGGTCGTACAGGAGGAGCACGT
TCCAGTCTTCGTCGTCGTCGACGGCGGCGGCGGCGAAGGGGAAGGGCGGCGGCGAGACGG
ATCAAGGGAGGAAGAATAAGGGAGGAGGGCTGTACGTGAAGGTGAGCATGGACGGGGCGC
CATACCTCCGCAAGGTCGACCTCCGGATGTACGGCGGCTACAGGGAGCTCAGGGACGCTC
TCGACGCGCTCTTCGGCTGCTTCTCCGCCGACGCCTCCGCCTCCGCCGCCCACTTCGCCG
TCGCCTATGAGGACAAGGACGGCGACCTCATGCTCGCCGGCGACGTGCCCTGGGACATGT
TCATCTCTTCTTGCAAGAAGCTGCGGATAATGCGAGGATCTGAGGCGAGATGATATATAT
CGAAATCGAAAGGCGTCGAGCTGAAGAAAAAATTTTCGCCGATGCATGCATGGAGTAGAC
ATCTCACAGAAAAAAGGCTTCATGCATGAGAGAGATGAGATCTATCCGTGGACATCGTCA
TGCATGGCGATCGGACGGCTGGCCAAGAAGGACACTTACACGTGGATGCATCTTGTTTTT
GTTCTACGTAGATGTGTAGATGAGATATCCAAGGATCTGAATTCTAAAAAAGTTCAGGAT
TCAGTTGGATCGGAGTTGGTGAGGAGGAGGATATGATCGATCGAGCAGAGCTGCAGTACT
CCTATGTACAGAATAATCTAGCTGAGATTTTGGTTGTTGGAAATGGCAACTGCTAGTTCT
GCAGATTTGTGTACACATGCCTTTTTTTTAAAGCTTTTTTTTTTCTAGCTTCTGTTGTGT
CACTGAAGAAATCTGAGAGCTGAAGAAAGAGAAACTTGGAAGTTTGGTC

CDS

594 bp

>Os03t0797800-01 AUX/IAA protein family protein.
ATGGCCATGGCGGCGGAGAGCATCGACGCGGAGCTGCGCCTCGGGCTGCCCGGCAGCGGC
GGCGGTGACGGCGTGGCGGCGAAGAAGCGGCGGTCGGCGTCGTCGACGGTGAAGAGCGAG
GCCTCCGGCACGGCCTGCTGCGGCGGCGCCGGCGCCCGGGACGTCGAAGACGGCGCCTCG
CCGGCGTCCAAAGTGCAGGTGGTGGGGTGGCCGCCGGTGGGGTCGTACAGGAGGAGCACG
TTCCAGTCTTCGTCGTCGTCGACGGCGGCGGCGGCGAAGGGGAAGGGCGGCGGCGAGACG
GATCAAGGGAGGAAGAATAAGGGAGGAGGGCTGTACGTGAAGGTGAGCATGGACGGGGCG
CCATACCTCCGCAAGGTCGACCTCCGGATGTACGGCGGCTACAGGGAGCTCAGGGACGCT
CTCGACGCGCTCTTCGGCTGCTTCTCCGCCGACGCCTCCGCCTCCGCCGCCCACTTCGCC
GTCGCCTATGAGGACAAGGACGGCGACCTCATGCTCGCCGGCGACGTGCCCTGGGACATG
TTCATCTCTTCTTGCAAGAAGCTGCGGATAATGCGAGGATCTGAGGCGAGATGA

Protein

198 aa

>Os03t0797800-01 AUX/IAA protein family protein.
MAMAAESIDAELRLGLPGSGGGDGVAAKKRRSASSTVKSEASGTACCGGAGARDVEDGAS
PASKVQVVGWPPVGSYRRSTFQSSSSSTAAAAKGKGGGETDQGRKNKGGGLYVKVSMDGA
PYLRKVDLRMYGGYRELRDALDALFGCFSADASASAAHFAVAYEDKDGDLMLAGDVPWDM
FISSCKKLRIMRGSEAR*

5'UTR

chr03:33247260..33247318 (- strand) : 59 bp

CDS

chr03:33247069..33247259 (- strand) : 191 bp

chr03:33246638..33246982 (- strand) : 345 bp

chr03:33246487..33246544 (- strand) : 58 bp

3'UTR

chr03:33246011..33246486 (- strand) : 476 bp

FASTA

>Os03t0797800-01 class=Sequence position=chr03:33246011..33247318 (- strand)
GACGACGAGG TCAGTGTCGC AGCGACGAAC GCCGACGAGC TAGCTCTCTC TCTCGATCGA TGGCCATGGC GGCGGAGAGC
ATCGACGCGG AGCTGCGCCT CGGGCTGCCC GGCAGCGGCG GCGGTGACGG CGTGGCGGCG AAGAAGCGGC GGTCGGCGTC
GTCGACGGTG AAGAGCGAGG CCTCCGGCAC GGCCTGCTGC GGCGGCGCCG GCGCCCGGGA CGTCGAAGAC GGCGCCTCGC
CGGCGTCCAA GTAAGTTCTA GCTCTAGCTC TCTCTCTCGC CATGTGTGCC AGCTCGATTT GCAGCCAATC TTACAATTTC
TTGTGTGGGT GAGCAGAGTG CAGGTGGTGG GGTGGCCGCC GGTGGGGTCG TACAGGAGGA GCACGTTCCA GTCTTCGTCG
TCGTCGACGG CGGCGGCGGC GAAGGGGAAG GGCGGCGGCG AGACGGATCA AGGGAGGAAG AATAAGGGAG GAGGGCTGTA
CGTGAAGGTG AGCATGGACG GGGCGCCATA CCTCCGCAAG GTCGACCTCC GGATGTACGG CGGCTACAGG GAGCTCAGGG
ACGCTCTCGA CGCGCTCTTC GGCTGCTTCT CCGCCGACGC CTCCGCCTCC GCCGCCCACT TCGCCGTCGC CTATGAGGAC
AAGGACGGCG ACCTCATGCT CGCCGGCGAC GTGCCCTGGG AGTAAGCACC ATACACACAC ATGTTAATTA TCCATCCATG
GAAAATCTTG TGTGTTTATT TGTCTCTAAT TTGAATCTTT TTGTGCTTTT GCAGCATGTT CATCTCTTCT TGCAAGAAGC
TGCGGATAAT GCGAGGATCT GAGGCGAGAT GATATATATC GAAATCGAAA GGCGTCGAGC TGAAGAAAAA ATTTTCGCCG
ATGCATGCAT GGAGTAGACA TCTCACAGAA AAAAGGCTTC ATGCATGAGA GAGATGAGAT CTATCCGTGG ACATCGTCAT
GCATGGCGAT CGGACGGCTG GCCAAGAAGG ACACTTACAC GTGGATGCAT CTTGTTTTTG TTCTACGTAG ATGTGTAGAT
GAGATATCCA AGGATCTGAA TTCTAAAAAA GTTCAGGATT CAGTTGGATC GGAGTTGGTG AGGAGGAGGA TATGATCGAT
CGAGCAGAGC TGCAGTACTC CTATGTACAG AATAATCTAG CTGAGATTTT GGTTGTTGGA AATGGCAACT GCTAGTTCTG
CAGATTTGTG TACACATGCC TTTTTTTTAA AGCTTTTTTT TTTCTAGCTT CTGTTGTGTC ACTGAAGAAA TCTGAGAGCT
GAAGAAAGAG AAACTTGGAA GTTTGGTC

Locus: Os03g0797800

Loading...

Locus: Os03g0797800

Loading...