Os03t0808100-01

Locus

Os03g0808100

Description

Similar to Cellulose synthase-5.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CESA2

CGSNL Gene Name

CELLULOSE SYNTHASE A2

Oryzabase Gene Symbol Synonym(s)

OsCesA2, OsCESA2, OS_CESA02

Oryzabase Gene Name Synonym(s)

Cellulose synthase A catalytic subunit 2 [UDP-forming], Cellulose synthase A catalytic subunit 2

Transcript Evidence

AK069196 (DDBJ, Best hit)

Protein Evidence

Q4U0Z5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Full-length cDNA

J023003G18 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0808100-01)

RiceXPro (AK069196)

Others

Oryzabase (9054)

KEGG (Os03t0808100-01 (EC:2.4.1.12))

Transcript

4278 bp

>Os03t0808100-01 Similar to Cellulose synthase-5.
CTCGCTGGTGCCACGTCCTTTTCTTGTCCCGTTTGATTCTTGCAAGCCTCCTCATCCAGC
TTGTGCTGCTAGCTACGAGGTCGGCTTTGGCGGTGGCGGGGGGCGCCTTGAATCCGAGGC
GATTTGGTGTCTGACTGATTGATTTGCCTCACTTGGGGTGGGGGGGAGTTGGGGTTTCTT
GGTTTCATCGGGGCGGCCGCGGAATGCGGTGAATTGGCGGGAGTCCGTTCGTGGAGACAC
TTTCTTGGCCGTGAGTTCTTGGTTCGTGCGCCATGGACGGTGCGAAATCGGGGAAGCAAT
GCCATGTCTGCCAGATCTGCGGCGACGGCGTGGGCACGGCGGCGGACGGCGAGCTCTTCA
CCGCCTGCGACGTCTGCGGGTTCCCGGTGTGCCGGCCATGCTACGAGTACGAGCGCAAGG
ACGGCAGCCAGGCGTGCCCGCAGTGCAAGACCAAGTACAAGCGCCACAAGGGGAGCCCGC
CGATACTTGGGGATGAAAGCGATGATGTTGATGCGGATGATGCTAGTGATGTGAACTATC
CAACATCCGGCAACCAGGACCATAAGCACAAGATTGCCGAGAGGATGCTCACCTGGCGCA
TGAACTCTGGGAGGAATGATGATATTGTCCATTCTAAGTATGATAGTGGTGAGATTGGTC
ATCCCAAGTATGACAGTGGTGAAATCCCTCGCATATATATCCCATCGCTCACTCACAGCC
AGATCTCAGGTGAAATTCCTGGAGCGTCCCCTGATCATATGATGTCTCCCGTTGGGAACA
TTGGCAGACGTGGGCATCCATTTCCCTATGTGAACCATTCACCAAACCCATCAAGGGAGT
TTTCTGGTAGCCTTGGCAATGTTGCATGGAAAGAGAGAGTAGATGGCTGGAAAATGAAGG
ATAAAGGTGCAATTCCCATGGCTAATGGTACTAGCATTGCTCCTTCAGAAGGTCGTGGGG
TTGGTGACATTGATGCATCTACTGACTATAACATGGAGGACGCCTTACTGAATGATGAAA
CACGCCAACCTCTATCGAGAAAAGTGCCAATTTCGTCATCCAGAATAAATCCGTACAGGA
TGGTTATTGTGCTCCGATTGATTGTCCTATGTATATTCTTGCACTACCGTATCACAAATC
CTGTGCGTAATGCATACCCGCTATGGTTGCTCTCTGTCATATGTGAGATTTGGTTTGCTC
TATCCTGGATTCTGGATCAGTTCCCCAAGTGGTCCCCAATCAACCGTGAAACTTACCTGG
ATAGGCTGGCTTTAAGGTATGACCGGGAAGGTGAACCATCTCAATTGGCTCCTGttgaca
tttttgtcagtactgtggatcctatgaaagaacctcctcttgtcactgccaatactgtgc
tctccatccttgctgtggattaccctgttgataaggtatcttgctatgtgtctgatgatg
gagctgcaatgttaacatttgatgcgcttgctgagacttcagaatttgctagaaaatggg
taccgttctgtaaaaagtacagcatagaacccagagctccagagtggtactttgcacaga
aaattgattacttgaaagacaaagttcaggcttcttttgttaaagaTCGTCGTGCCATGA
AGAGGGAATATGAAGAATTTAAAGTTCGTGTTAATGCTCTCGTCGCCAAGGCACAGAAAG
TTCCTGAGGAAGGATGGATTATGCAAGATGGCACACCTTGGCCTGGTAACAATACCAGAG
ACCATCCTGGAATGATTCAGGTTTTCCTTGGTCATAGTGGAGGCCTTGATACCGAAGGCA
ATGagcttcctcgtttagtctatgtgtctcgtgagaaacgtcctggattccaacaccata
aaaaggctggtgctatgaatgcacttgttcgtgtatcagctgtccttactaatggacaat
ACTTGTTGAATCTTGACTGTGATCACTACATCAACAATAGCAAAGCTCTCCGAGAGGCTA
TGTGCTTCCTTATGGATCCAAACCTAGGAAGGCGTGTCTGTTATGTCCAATTCCCTCAGA
GGTTTGACGGTATCGATAGAAATGATCGATATGCAAACAGGAACACCGTGTTTTTCGATA
TTAATTTGAGAGGTCTCGATGGTCTCCAAGGACCAGTTTATGTGGGAACCGGTTGTGTGT
TCAACAGAACAGCTCTTTATGGTTATGAACCCCCCATTAAGCAGAAGAGGCCAGGTTACT
TCTCTTCGCTTTGTGGGGGACGAAAGAAGACAAAAAAGTCGAAGGAGAAGAGCACGGAAA
AGAAAAAGTCACACAAACATGTGGACAGTTCTGTGCCAGTTTTTAATCTTGAAGATATAG
AGGAAGGGATTGAAGGTTCTGGATTTGATGATGAGAAATCACTACTGATGTCTCAAATGA
GCTTAGAGAAAAGATTTGGTCAATCTAGTGTTTTTGTAGCCTCCACTCTGATGGAATATG
GTGGTGTTCCTCAATCCGCAACTCCAGAATCTCTTCTGAAAGAGGCCATACATGTTATCA
GCTGTGGCTATGAAGACAAAAGTGACTGGGGAACTGAGAttggatggatctatggttctg
ttacagaagatattctcactggattcaagatgcatgcacgtggctggcggtcaatctact
gcatgcctaagcgaccagcattcaaggggtctgccccaattaatctttcggatcgtctga
accaggtgcttcggtgggctcttggttctgtggaaattctttttagcaggcattgtccca
tatggtatgggtacggaggacggcttaagttcctggagagatttgcttacatcaacacca
ctatttatccactcacatcgattccactcctcttgtactgcatattgccagctatctgtc
ttctcactgggaagttcatcataccagagattagcaactttgcgagtatttggtttatct
ctctctttctgtcaatctttgctactggtatccttgagatgaggtggagtggtgttggca
tcgatgaatggtggaggaatgagcagttttgggttattggaggtatttccgctcatctat
ttgcggtcttccagggtctgctgaaggtgcttgctggaattgataccagcttcactgtca
cctcaaaggcctctgatgaagaaggcgatttcgctgagctctacatgttcaagtggacaa
cccttctgatcccaccgaccactattttgatcatcaacctggtcggtgttgttgctggta
tctcctacgctatcaacagtggctaccagtcatggggtccgctctttgggaagctcttct
ttgccttctgggtgattgtccacctgtaccccttccttaagggtctcatgggtcggcaga
accgtacaccgaccattgttgttgtttgggccatcctccttgcatcgatcttctccttgc
tgtgggtTCGTATCGATCCATTCACCACCCGTGTCACAGGCCCTGATACCCAAAAATGTG
GTATCAACTGCTAGGAGTGAGCAAGATAGTAGGCAAAGAATCGCCAGTTTGCTATCCATT
CTGTTGTGTAAGTTATTAGTGGATGACTCTATATAGTCTACTGTAAGATCTTAGCTGCCG
GAATGCTTGTTATGTATTAAGGAGTAGTAAGTGGTACCTTGCTGTTCATCTGTTGATAAT
TAAGTTAGTAGAACTACTTTGCTGAAAAATGCCTGACAACATTCTGCTGCACTTAATGGG
AATATGAAATCAATGTTGCTCTGTATGAAAGAATTTACATGTATATAACTTGAATCAATT
TAACAAATACACTCTGTAGCCTTGTAGGCACACTGCATTGCAGGTTCCTGGTAGAAACCC
CAATGAGTGTATGCACAATGTATGCATAAATATGACTGATTCCTTCTGAATTTTTTTATA
CACACTTTATACAGTAATGAACTTTATCAGGCCCAGTTCCTCCTAATTTGTGCTGGTGCA
TGGTTGTGGAACAACTGTTCCAGATTTCCTCCATTTTGCATTCTGGCAAGTACTTCCTGT
GGCACCATTGTCATCCACCATTTCCAGGTTGATGTCCTGTAAGGAAATGTCATAGCATGG
GTAGTTCTTGCTGCAGTTCAGAGTGATGGCACTCTTGGAAATTGTTGTCCCTGCGATGTT
CTTGAAGACCACATTGCTAATCTCCACTGCTGATCCCTGAGATCCATGTTCATGGCAAAT
TTGCAATAATTGTGTGATTTGGATGATTTTTGTTGAGCATTACTCACTGGTGTTAAATAA
AGGATTGGTTTTTGAGAG

CDS

3222 bp

>Os03t0808100-01 Similar to Cellulose synthase-5.
ATGGACGGTGCGAAATCGGGGAAGCAATGCCATGTCTGCCAGATCTGCGGCGACGGCGTG
GGCACGGCGGCGGACGGCGAGCTCTTCACCGCCTGCGACGTCTGCGGGTTCCCGGTGTGC
CGGCCATGCTACGAGTACGAGCGCAAGGACGGCAGCCAGGCGTGCCCGCAGTGCAAGACC
AAGTACAAGCGCCACAAGGGGAGCCCGCCGATACTTGGGGATGAAAGCGATGATGTTGAT
GCGGATGATGCTAGTGATGTGAACTATCCAACATCCGGCAACCAGGACCATAAGCACAAG
ATTGCCGAGAGGATGCTCACCTGGCGCATGAACTCTGGGAGGAATGATGATATTGTCCAT
TCTAAGTATGATAGTGGTGAGATTGGTCATCCCAAGTATGACAGTGGTGAAATCCCTCGC
ATATATATCCCATCGCTCACTCACAGCCAGATCTCAGGTGAAATTCCTGGAGCGTCCCCT
GATCATATGATGTCTCCCGTTGGGAACATTGGCAGACGTGGGCATCCATTTCCCTATGTG
AACCATTCACCAAACCCATCAAGGGAGTTTTCTGGTAGCCTTGGCAATGTTGCATGGAAA
GAGAGAGTAGATGGCTGGAAAATGAAGGATAAAGGTGCAATTCCCATGGCTAATGGTACT
AGCATTGCTCCTTCAGAAGGTCGTGGGGTTGGTGACATTGATGCATCTACTGACTATAAC
ATGGAGGACGCCTTACTGAATGATGAAACACGCCAACCTCTATCGAGAAAAGTGCCAATT
TCGTCATCCAGAATAAATCCGTACAGGATGGTTATTGTGCTCCGATTGATTGTCCTATGT
ATATTCTTGCACTACCGTATCACAAATCCTGTGCGTAATGCATACCCGCTATGGTTGCTC
TCTGTCATATGTGAGATTTGGTTTGCTCTATCCTGGATTCTGGATCAGTTCCCCAAGTGG
TCCCCAATCAACCGTGAAACTTACCTGGATAGGCTGGCTTTAAGGTATGACCGGGAAGGT
GAACCATCTCAATTGGCTCCTGttgacatttttgtcagtactgtggatcctatgaaagaa
cctcctcttgtcactgccaatactgtgctctccatccttgctgtggattaccctgttgat
aaggtatcttgctatgtgtctgatgatggagctgcaatgttaacatttgatgcgcttgct
gagacttcagaatttgctagaaaatgggtaccgttctgtaaaaagtacagcatagaaccc
agagctccagagtggtactttgcacagaaaattgattacttgaaagacaaagttcaggct
tcttttgttaaagaTCGTCGTGCCATGAAGAGGGAATATGAAGAATTTAAAGTTCGTGTT
AATGCTCTCGTCGCCAAGGCACAGAAAGTTCCTGAGGAAGGATGGATTATGCAAGATGGC
ACACCTTGGCCTGGTAACAATACCAGAGACCATCCTGGAATGATTCAGGTTTTCCTTGGT
CATAGTGGAGGCCTTGATACCGAAGGCAATGagcttcctcgtttagtctatgtgtctcgt
gagaaacgtcctggattccaacaccataaaaaggctggtgctatgaatgcacttgttcgt
gtatcagctgtccttactaatggacaatACTTGTTGAATCTTGACTGTGATCACTACATC
AACAATAGCAAAGCTCTCCGAGAGGCTATGTGCTTCCTTATGGATCCAAACCTAGGAAGG
CGTGTCTGTTATGTCCAATTCCCTCAGAGGTTTGACGGTATCGATAGAAATGATCGATAT
GCAAACAGGAACACCGTGTTTTTCGATATTAATTTGAGAGGTCTCGATGGTCTCCAAGGA
CCAGTTTATGTGGGAACCGGTTGTGTGTTCAACAGAACAGCTCTTTATGGTTATGAACCC
CCCATTAAGCAGAAGAGGCCAGGTTACTTCTCTTCGCTTTGTGGGGGACGAAAGAAGACA
AAAAAGTCGAAGGAGAAGAGCACGGAAAAGAAAAAGTCACACAAACATGTGGACAGTTCT
GTGCCAGTTTTTAATCTTGAAGATATAGAGGAAGGGATTGAAGGTTCTGGATTTGATGAT
GAGAAATCACTACTGATGTCTCAAATGAGCTTAGAGAAAAGATTTGGTCAATCTAGTGTT
TTTGTAGCCTCCACTCTGATGGAATATGGTGGTGTTCCTCAATCCGCAACTCCAGAATCT
CTTCTGAAAGAGGCCATACATGTTATCAGCTGTGGCTATGAAGACAAAAGTGACTGGGGA
ACTGAGAttggatggatctatggttctgttacagaagatattctcactggattcaagatg
catgcacgtggctggcggtcaatctactgcatgcctaagcgaccagcattcaaggggtct
gccccaattaatctttcggatcgtctgaaccaggtgcttcggtgggctcttggttctgtg
gaaattctttttagcaggcattgtcccatatggtatgggtacggaggacggcttaagttc
ctggagagatttgcttacatcaacaccactatttatccactcacatcgattccactcctc
ttgtactgcatattgccagctatctgtcttctcactgggaagttcatcataccagagatt
agcaactttgcgagtatttggtttatctctctctttctgtcaatctttgctactggtatc
cttgagatgaggtggagtggtgttggcatcgatgaatggtggaggaatgagcagttttgg
gttattggaggtatttccgctcatctatttgcggtcttccagggtctgctgaaggtgctt
gctggaattgataccagcttcactgtcacctcaaaggcctctgatgaagaaggcgatttc
gctgagctctacatgttcaagtggacaacccttctgatcccaccgaccactattttgatc
atcaacctggtcggtgttgttgctggtatctcctacgctatcaacagtggctaccagtca
tggggtccgctctttgggaagctcttctttgccttctgggtgattgtccacctgtacccc
ttccttaagggtctcatgggtcggcagaaccgtacaccgaccattgttgttgtttgggcc
atcctccttgcatcgatcttctccttgctgtgggtTCGTATCGATCCATTCACCACCCGT
GTCACAGGCCCTGATACCCAAAAATGTGGTATCAACTGCTAG

Protein

1073 aa

>Os03t0808100-01 Similar to Cellulose synthase-5.
MDGAKSGKQCHVCQICGDGVGTAADGELFTACDVCGFPVCRPCYEYERKDGSQACPQCKT
KYKRHKGSPPILGDESDDVDADDASDVNYPTSGNQDHKHKIAERMLTWRMNSGRNDDIVH
SKYDSGEIGHPKYDSGEIPRIYIPSLTHSQISGEIPGASPDHMMSPVGNIGRRGHPFPYV
NHSPNPSREFSGSLGNVAWKERVDGWKMKDKGAIPMANGTSIAPSEGRGVGDIDASTDYN
MEDALLNDETRQPLSRKVPISSSRINPYRMVIVLRLIVLCIFLHYRITNPVRNAYPLWLL
SVICEIWFALSWILDQFPKWSPINRETYLDRLALRYDREGEPSQLAPVDIFVSTVDPMKE
PPLVTANTVLSILAVDYPVDKVSCYVSDDGAAMLTFDALAETSEFARKWVPFCKKYSIEP
RAPEWYFAQKIDYLKDKVQASFVKDRRAMKREYEEFKVRVNALVAKAQKVPEEGWIMQDG
TPWPGNNTRDHPGMIQVFLGHSGGLDTEGNELPRLVYVSREKRPGFQHHKKAGAMNALVR
VSAVLTNGQYLLNLDCDHYINNSKALREAMCFLMDPNLGRRVCYVQFPQRFDGIDRNDRY
ANRNTVFFDINLRGLDGLQGPVYVGTGCVFNRTALYGYEPPIKQKRPGYFSSLCGGRKKT
KKSKEKSTEKKKSHKHVDSSVPVFNLEDIEEGIEGSGFDDEKSLLMSQMSLEKRFGQSSV
FVASTLMEYGGVPQSATPESLLKEAIHVISCGYEDKSDWGTEIGWIYGSVTEDILTGFKM
HARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLRWALGSVEILFSRHCPIWYGYGGRLKF
LERFAYINTTIYPLTSIPLLLYCILPAICLLTGKFIIPEISNFASIWFISLFLSIFATGI
LEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQGLLKVLAGIDTSFTVTSKASDEEGDF
AELYMFKWTTLLIPPTTILIINLVGVVAGISYAINSGYQSWGPLFGKLFFAFWVIVHLYP
FLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRIDPFTTRVTGPDTQKCGINC*

5'UTR

chr03:33785988..33786259 (- strand) : 272 bp

CDS

chr03:33785976..33785987 (- strand) : 12 bp

chr03:33785656..33785842 (- strand) : 187 bp

chr03:33785073..33785323 (- strand) : 251 bp

chr03:33784871..33784970 (- strand) : 100 bp

chr03:33784606..33784792 (- strand) : 187 bp

chr03:33784044..33784310 (- strand) : 267 bp

chr03:33783605..33783950 (- strand) : 346 bp

chr03:33783379..33783516 (- strand) : 138 bp

chr03:33783171..33783296 (- strand) : 126 bp

chr03:33782873..33783085 (- strand) : 213 bp

chr03:33782458..33782713 (- strand) : 256 bp

chr03:33782060..33782262 (- strand) : 203 bp

chr03:33781466..33781816 (- strand) : 351 bp

chr03:33780799..33781383 (- strand) : 585 bp

3'UTR

chr03:33780015..33780798 (- strand) : 784 bp

FASTA

>Os03t0808100-01 class=Sequence position=chr03:33780015..33786259 (- strand)
CTCGCTGGTG CCACGTCCTT TTCTTGTCCC GTTTGATTCT TGCAAGCCTC CTCATCCAGC TTGTGCTGCT AGCTACGAGG
TCGGCTTTGG CGGTGGCGGG GGGCGCCTTG AATCCGAGGC GATTTGGTGT CTGACTGATT GATTTGCCTC ACTTGGGGTG
GGGGGGAGTT GGGGTTTCTT GGTTTCATCG GGGCGGCCGC GGAATGCGGT GAATTGGCGG GAGTCCGTTC GTGGAGACAC
TTTCTTGGCC GTGAGTTCTT GGTTCGTGCG CCATGGACGG TGCGGTGAGT CGCATTTTCG GGGGGAAAGA TTCAAAGATT
GGTTAATTTG TTGCGTGGAT GTTTGGGTTG GTCTGAGCTC TGAAGCTTTT GCCTTTGTTT GTTTGTTTCG TTTGGTGTTG
TTGTATGCGC GGCGAAGAAA TCGGGGAAGC AATGCCATGT CTGCCAGATC TGCGGCGACG GCGTGGGCAC GGCGGCGGAC
GGCGAGCTCT TCACCGCCTG CGACGTCTGC GGGTTCCCGG TGTGCCGGCC ATGCTACGAG TACGAGCGCA AGGACGGCAG
CCAGGCGTGC CCGCAGTGCA AGACCAAGTA CAAGCGCCAC AAGGGTATAA GTTGCACATT ATCCATTCAT CCTTCTCTTG
GATTTCACCT AAATACTTCA TCTTTGGTTA AGAACAGCTA CATTGGACTG AACATCTCGT GAACCCAATC AGGTTGTTGC
ATATTGCATT TAGACAATAA TAGTAGAGAA GATATATATA TGCTTAGTGA ATATGCTGAG TTAATAGCAC AGAGTCCTGT
TCTTTAGTGA GCTGTATTCG AAGTTGGTAG TGACCAGTGA CAACATAATT TCTTTCCTGT ATGGGTTATT TCCATTGAGA
GAAGCAAATG TGAGTGAATT TGTTGAGCTT AACAAGATAT TTAATCTTTG CTTCAGGGAG CCCGCCGATA CTTGGGGATG
AAAGCGATGA TGTTGATGCG GATGATGCTA GTGATGTGAA CTATCCAACA TCCGGCAACC AGGACCATAA GCACAAGATT
GCCGAGAGGA TGCTCACCTG GCGCATGAAC TCTGGGAGGA ATGATGATAT TGTCCATTCT AAGTATGATA GTGGTGAGAT
TGGTCATCCC AAGTATGACA GTGGTGAAAT CCCTCGCATA TATATCCCAT CGCTCACTCA CAGCCAGGTT TGTTAGAATT
TTTGTTGATA GCGTGAAGTC GTTAACCCTT CAGGGTATGT GCAAAGATTG AACTAATATT TAGTTTCTTC CTCTCGATTA
ATTCTATAGA TCTCAGGTGA AATTCCTGGA GCGTCCCCTG ATCATATGAT GTCTCCCGTT GGGAACATTG GCAGACGTGG
GCATCCATTT CCCTATGTGA ACCATTCACG TAAGTTTATC TATCATCAAG ATCTCATGTT TCGTTGCATC GACTGGGAAA
ATTTAATTAT TCTTTGTTGC TCAACAGCAA ACCCATCAAG GGAGTTTTCT GGTAGCCTTG GCAATGTTGC ATGGAAAGAG
AGAGTAGATG GCTGGAAAAT GAAGGATAAA GGTGCAATTC CCATGGCTAA TGGTACTAGC ATTGCTCCTT CAGAAGGTCG
TGGGGTTGGT GACATTGATG CATCTACTGA CTATAACATG GAGGACGCCT TACTGTGAGT TCTGATATGC TTTTGTCCAC
CGTTAGTCAT CTATGAATTC TACCAGTAAT TAATATTCCT TGTATCTGGT GTACTAACTT GCACTAGTTT GTACTTGGAA
GAACATAGGA AAAATTCTTG CATAATTCGA AATATAATTA TTTTGTGTTT ACAAGTATAC CTTGCTATTA AGCAAGGCAA
TATGCACATT TAATGGATCA GATTCTAAAT GGTTGTACAT CTCTGAACCT TATAATGCGG ACTTATCATA TAGCTTGCCA
CTATAAATGT TGTGCTATCT GTATTACAGG AATGATGAAA CACGCCAACC TCTATCGAGA AAAGTGCCAA TTTCGTCATC
CAGAATAAAT CCGTACAGGA TGGTTATTGT GCTCCGATTG ATTGTCCTAT GTATATTCTT GCACTACCGT ATCACAAATC
CTGTGCGTAA TGCATACCCG CTATGGTTGC TCTCTGTCAT ATGTGAGATT TGGTTTGCTC TATCCTGGAT TCTGGATCAG
TTCCCCAAGT GGTCCCCAAT CAACCGTGAA ACTTACCTGG ATAGGCTGGC TTTAAGGTGA TGTACAATAT TTACCTCTGA
TACACCATTC CTGCGTTAGC ACTGTAGTAC TGATTACTGA CAATAACAAA ATATCACTTG CACTCTCAGG TATGACCGGG
AAGGTGAACC ATCTCAATTG GCTCCTGttg acatttttgt cagtactgtg gatcctatga aagaacctcc tcttgtcact
gccaatactg tgctctccat ccttgctgtg gattaccctg ttgataaggt atcttgctat gtgtctgatg atggagctgc
aatgttaaca tttgatgcgc ttgctgagac ttcagaattt gctagaaaat gggtaccgtt ctgtaaaaag tacagcatag
aacccagagc tccagagtgg tactttgcac agaaaattga ttacttgaaa gacaaagttc aggcttcttt tgttaaagaT
CGTCGTGCCA TGAAGGTAAA TTTGGTTTAT ATGTGTGTAC TTTTTTGTTG TTTTTTTTTT GGTGTAATCT CGCATTAATG
TCTGTTGCAA AACCAAAATC CAGAGGGAAT ATGAAGAATT TAAAGTTCGT GTTAATGCTC TCGTCGCCAA GGCACAGAAA
GTTCCTGAGG AAGGATGGAT TATGCAAGAT GGCACACCTT GGCCTGGTAA CAATACCAGA GACCATCCTG GAATGATTCA
GGTAAATATC ACTTAGATAT TGCCATTGTG GTGTGGTTAT TGATCCAGCA ATTTTCTTAC TCTTGACGTC TGGTCATGCT
CAGGTTTTCC TTGGTCATAG TGGAGGCCTT GATACCGAAG GCAATGagct tcctcgttta gtctatgtgt ctcgtgagaa
acgtcctgga ttccaacacc ataaaaaggc tggtgctatg aatgcacttg tgagtagcag ctagagtggt gttgcttaag
tgagaagtat cttgtttaat tcatttactt gatatgtgga atttgaaact gcaggttcgt gtatcagctg tccttactaa
tggacaatAC TTGTTGAATC TTGACTGTGA TCACTACATC AACAATAGCA AAGCTCTCCG AGAGGCTATG TGCTTCCTTA
TGGATCCAAA CCTAGGAAGG CGTGTCTGTT ATGTCCAATT CCCTCAGAGG TTTGACGGTA TCGATAGAAA TGATCGATAT
GCAAACAGGA ACACCGTGTT TTTCGATGTA AGCTTGGTTC CCTTTAAGAT TCTTGGATGC TTCACTTCAC GCTTTAGCAA
ACATCAATAA CTGTTGATGG ATCAGCAATA TTTATGTTTC TATGTGATGG ATTTGAACAT TTCTGGAGTT TGTCAAGTAA
CTTATCTGCA TTTCTGCTTG CTGCAGATTA ATTTGAGAGG TCTCGATGGT CTCCAAGGAC CAGTTTATGT GGGAACCGGT
TGTGTGTTCA ACAGAACAGC TCTTTATGGT TATGAACCCC CCATTAAGCA GAAGAGGCCA GGTTACTTCT CTTCGCTTTG
TGGGGGACGA AAGAAGACAA AAAAGTCGAA GGAGAAGAGC ACGGAAAAGA AAAAGTCACA CAAACATGTG GACAGTTCTG
TGCCAGTTTT TAATCTTGAA GATATAGAGG AAGGGATTGA AGGTACCATC GAGTCTGGTT TTTGTTCAAT TACATGTTTT
TGCTCTTAGA TTTTTAGTGA TATTTGGCCA CCACCATTGC ATTGCACCCC ACAACTTTTT TCGCAGTATT TCTGTATATG
CTTAGGAAGG GAGGGACACT AGGCTTAACT TTTCTCTTAC ACTATATATT TGACCTGGCA CATCATTTTT GTGGCAGGTT
CTGGATTTGA TGATGAGAAA TCACTACTGA TGTCTCAAAT GAGCTTAGAG AAAAGATTTG GTCAATCTAG TGTTTTTGTA
GCCTCCACTC TGATGGAATA TGGTGGTGTT CCTCAATCCG CAACTCCAGA ATCTCTTCTG AAAGAGGCCA TACATGTTAT
CAGCTGTGGC TATGAAGACA AAAGTGACTG GGGAACTGAG GTAATAAAGC TATGGCATTC ATGCTCTGCA TTACATGCTA
CTAGCCTACC AGTACAAATT ATACAATGTA ACAGAAAATG TCGAGATATC AAGTGGTCTT TCTTGTACAA AATTAAGGAC
GCAATTTGAT TTCTGTTCTG ATTCGCACAA GTACTTCTGA GTTCATGCGA AGAAACTTGA CTAAATTGGC ATCTCCTCTC
AGTTGCCATT ATAACTTTGT TTATGATGCT ATGTGACTTG CAGAttggat ggatctatgg ttctgttaca gaagatattc
tcactggatt caagatgcat gcacgtggct ggcggtcaat ctactgcatg cctaagcgac cagcattcaa ggggtctgcc
ccaattaatc tttcggatcg tctgaaccag gtgcttcggt gggctcttgg ttctgtggaa attcttttta gcaggcattg
tcccatatgg tatgggtacg gaggacggct taagttcctg gagagatttg cttacatcaa caccactatt tatccactca
catcgattcc actcctcttg tactgcatat tgccagctat ctgtcttctc actgggaagt tcatcatacc agaggtaaat
atgtagaatt gtttttcctc ttctgcagac gaaatcgcag aacagcatgc gctgactgac ttattttgga ctgcagatta
gcaactttgc gagtatttgg tttatctctc tctttctgtc aatctttgct actggtatcc ttgagatgag gtggagtggt
gttggcatcg atgaatggtg gaggaatgag cagttttggg ttattggagg tatttccgct catctatttg cggtcttcca
gggtctgctg aaggtgcttg ctggaattga taccagcttc actgtcacct caaaggcctc tgatgaagaa ggcgatttcg
ctgagctcta catgttcaag tggacaaccc ttctgatccc accgaccact attttgatca tcaacctggt cggtgttgtt
gctggtatct cctacgctat caacagtggc taccagtcat ggggtccgct ctttgggaag ctcttctttg ccttctgggt
gattgtccac ctgtacccct tccttaaggg tctcatgggt cggcagaacc gtacaccgac cattgttgtt gtttgggcca
tcctccttgc atcgatcttc tccttgctgt gggtTCGTAT CGATCCATTC ACCACCCGTG TCACAGGCCC TGATACCCAA
AAATGTGGTA TCAACTGCTA GGAGTGAGCA AGATAGTAGG CAAAGAATCG CCAGTTTGCT ATCCATTCTG TTGTGTAAGT
TATTAGTGGA TGACTCTATA TAGTCTACTG TAAGATCTTA GCTGCCGGAA TGCTTGTTAT GTATTAAGGA GTAGTAAGTG
GTACCTTGCT GTTCATCTGT TGATAATTAA GTTAGTAGAA CTACTTTGCT GAAAAATGCC TGACAACATT CTGCTGCACT
TAATGGGAAT ATGAAATCAA TGTTGCTCTG TATGAAAGAA TTTACATGTA TATAACTTGA ATCAATTTAA CAAATACACT
CTGTAGCCTT GTAGGCACAC TGCATTGCAG GTTCCTGGTA GAAACCCCAA TGAGTGTATG CACAATGTAT GCATAAATAT
GACTGATTCC TTCTGAATTT TTTTATACAC ACTTTATACA GTAATGAACT TTATCAGGCC CAGTTCCTCC TAATTTGTGC
TGGTGCATGG TTGTGGAACA ACTGTTCCAG ATTTCCTCCA TTTTGCATTC TGGCAAGTAC TTCCTGTGGC ACCATTGTCA
TCCACCATTT CCAGGTTGAT GTCCTGTAAG GAAATGTCAT AGCATGGGTA GTTCTTGCTG CAGTTCAGAG TGATGGCACT
CTTGGAAATT GTTGTCCCTG CGATGTTCTT GAAGACCACA TTGCTAATCT CCACTGCTGA TCCCTGAGAT CCATGTTCAT
GGCAAATTTG CAATAATTGT GTGATTTGGA TGATTTTTGT TGAGCATTAC TCACTGGTGT TAAATAAAGG ATTGGTTTTT
GAGAG

Locus: Os03g0808100

Loading...

Locus: Os03g0808100

Loading...