Os03t0808100-02

Locus

Os03g0808100

Description

Similar to Cellulose synthase BoCesA5.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CESA2

CGSNL Gene Name

CELLULOSE SYNTHASE A2

Oryzabase Gene Symbol Synonym(s)

OsCesA2, OsCESA2, OS_CESA02

Oryzabase Gene Name Synonym(s)

Cellulose synthase A catalytic subunit 2 [UDP-forming], Cellulose synthase A catalytic subunit 2

Transcript Evidence

AK058615 (DDBJ, Best hit)

Protein Evidence

Q4U0Z5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Full-length cDNA

001-018-B02 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0808100-02)

RiceXPro (AK058615)

Others

Oryzabase (9054)

KEGG (Os03t0808100-02 (EC:2.4.1.12))

Transcript

856 bp

>Os03t0808100-02 Similar to Cellulose synthase BoCesA5.
GGTTATTGTGCTCCGATTGATTGTCCTATGTATATTCTTGCACTACCGTATCACAAATCC
TGTGCGTAATGCATACCCGCTATGGTTGCTCTCTGTCATATGTGAGATTTGGTTTGCTCT
ATCCTGGATTCTGGATCAGTTCCCCAAGTGGTCCCCAATCAACCGTGAAACTTACCTGGA
TAGGCTGGCTTTAAGGTATGACCGGGAAGGTGAACCATCTCAATTGGCTCCTGttgacat
ttttgtcagtactgtggatcctatgaaagaacctcctcttgtcactgccaatactgtgct
ctccatccttgctgtggattaccctgttgataaggtatcttgctatgtgtctgatgatgg
agctgcaatgttaacatttgatgcgcttgctgagacttcagaatttgctagaaaatgggt
accgttctgtaaaaagtacagcatagaacccagagctccagagtggtactttgcacagaa
aattgattacttgaaagacaaagttcaggcttcttttgttaaagaTCGTCGTGCCATGAA
GAGGGAATATGAAGAATTTAAAGTTCGTGTTAATGCTCTCGTCGCCAAGGCACAGAAAGT
TCCTGAGGAAGGATGGATTATGCAAGATGGCACACCTTGGCCTGGTAACAATACCAGAGA
CCATCCTGGAATGATTCAGGTTTTCCTTGGTCATAGTGGAGGCCTTGATACCGAAGGCAA
TGagcttcctcgtttagtctatgtgtctcgtgagaaacgtcctggattccaacaccataa
aaaggctggtgctatgaatgcacttgttcgtgtatcagctgtccttactaatggacaatA
CTTGTTGAATCTTGAC

CDS

855 bp

>Os03t0808100-02 Similar to Cellulose synthase BoCesA5.
GTTATTGTGCTCCGATTGATTGTCCTATGTATATTCTTGCACTACCGTATCACAAATCCT
GTGCGTAATGCATACCCGCTATGGTTGCTCTCTGTCATATGTGAGATTTGGTTTGCTCTA
TCCTGGATTCTGGATCAGTTCCCCAAGTGGTCCCCAATCAACCGTGAAACTTACCTGGAT
AGGCTGGCTTTAAGGTATGACCGGGAAGGTGAACCATCTCAATTGGCTCCTGttgacatt
tttgtcagtactgtggatcctatgaaagaacctcctcttgtcactgccaatactgtgctc
tccatccttgctgtggattaccctgttgataaggtatcttgctatgtgtctgatgatgga
gctgcaatgttaacatttgatgcgcttgctgagacttcagaatttgctagaaaatgggta
ccgttctgtaaaaagtacagcatagaacccagagctccagagtggtactttgcacagaaa
attgattacttgaaagacaaagttcaggcttcttttgttaaagaTCGTCGTGCCATGAAG
AGGGAATATGAAGAATTTAAAGTTCGTGTTAATGCTCTCGTCGCCAAGGCACAGAAAGTT
CCTGAGGAAGGATGGATTATGCAAGATGGCACACCTTGGCCTGGTAACAATACCAGAGAC
CATCCTGGAATGATTCAGGTTTTCCTTGGTCATAGTGGAGGCCTTGATACCGAAGGCAAT
Gagcttcctcgtttagtctatgtgtctcgtgagaaacgtcctggattccaacaccataaa
aaggctggtgctatgaatgcacttgttcgtgtatcagctgtccttactaatggacaatAC
TTGTTGAATCTTGAC

Protein

284 aa

>Os03t0808100-02 Similar to Cellulose synthase BoCesA5.
VIVLRLIVLCIFLHYRITNPVRNAYPLWLLSVICEIWFALSWILDQFPKWSPINRETYLD
RLALRYDREGEPSQLAPVDIFVSTVDPMKEPPLVTANTVLSILAVDYPVDKVSCYVSDDG
AAMLTFDALAETSEFARKWVPFCKKYSIEPRAPEWYFAQKIDYLKDKVQASFVKDRRAMK
REYEEFKVRVNALVAKAQKVPEEGWIMQDGTPWPGNNTRDHPGMIQVFLGHSGGLDTEGN
ELPRLVYVSREKRPGFQHHKKAGAMNALVRVSAVLTNGQYLLNLD

5'UTR

chr03:33784238..33784238 (- strand) : 1 bp

CDS

chr03:33784044..33784237 (- strand) : 194 bp

chr03:33783605..33783950 (- strand) : 346 bp

chr03:33783379..33783516 (- strand) : 138 bp

chr03:33783171..33783296 (- strand) : 126 bp

chr03:33783035..33783085 (- strand) : 51 bp

FASTA

>Os03t0808100-02 class=Sequence position=chr03:33783035..33784238 (- strand)
GGTTATTGTG CTCCGATTGA TTGTCCTATG TATATTCTTG CACTACCGTA TCACAAATCC TGTGCGTAAT GCATACCCGC
TATGGTTGCT CTCTGTCATA TGTGAGATTT GGTTTGCTCT ATCCTGGATT CTGGATCAGT TCCCCAAGTG GTCCCCAATC
AACCGTGAAA CTTACCTGGA TAGGCTGGCT TTAAGGTGAT GTACAATATT TACCTCTGAT ACACCATTCC TGCGTTAGCA
CTGTAGTACT GATTACTGAC AATAACAAAA TATCACTTGC ACTCTCAGGT ATGACCGGGA AGGTGAACCA TCTCAATTGG
CTCCTGttga catttttgtc agtactgtgg atcctatgaa agaacctcct cttgtcactg ccaatactgt gctctccatc
cttgctgtgg attaccctgt tgataaggta tcttgctatg tgtctgatga tggagctgca atgttaacat ttgatgcgct
tgctgagact tcagaatttg ctagaaaatg ggtaccgttc tgtaaaaagt acagcataga acccagagct ccagagtggt
actttgcaca gaaaattgat tacttgaaag acaaagttca ggcttctttt gttaaagaTC GTCGTGCCAT GAAGGTAAAT
TTGGTTTATA TGTGTGTACT TTTTTGTTGT TTTTTTTTTG GTGTAATCTC GCATTAATGT CTGTTGCAAA ACCAAAATCC
AGAGGGAATA TGAAGAATTT AAAGTTCGTG TTAATGCTCT CGTCGCCAAG GCACAGAAAG TTCCTGAGGA AGGATGGATT
ATGCAAGATG GCACACCTTG GCCTGGTAAC AATACCAGAG ACCATCCTGG AATGATTCAG GTAAATATCA CTTAGATATT
GCCATTGTGG TGTGGTTATT GATCCAGCAA TTTTCTTACT CTTGACGTCT GGTCATGCTC AGGTTTTCCT TGGTCATAGT
GGAGGCCTTG ATACCGAAGG CAATGagctt cctcgtttag tctatgtgtc tcgtgagaaa cgtcctggat tccaacacca
taaaaaggct ggtgctatga atgcacttgt gagtagcagc tagagtggtg ttgcttaagt gagaagtatc ttgtttaatt
catttacttg atatgtggaa tttgaaactg caggttcgtg tatcagctgt ccttactaat ggacaatACT TGTTGAATCT
TGAC

Locus: Os03g0808100

Loading...

Locus: Os03g0808100

Loading...