Os03t0808100-03

Locus

Os03g0808100

Description

Similar to Cellulose synthase BoCesA5.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CESA2

CGSNL Gene Name

CELLULOSE SYNTHASE A2

Oryzabase Gene Symbol Synonym(s)

OsCesA2, OsCESA2, OS_CESA02

Oryzabase Gene Name Synonym(s)

Cellulose synthase A catalytic subunit 2 [UDP-forming], Cellulose synthase A catalytic subunit 2

Transcript Evidence

AK061688 (DDBJ, Best hit)

Protein Evidence

Q4U0Z5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Full-length cDNA

001-037-B05 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0808100-03)

RiceXPro (AK061688)

Others

Oryzabase (9054)

KEGG (Os03t0808100-03 (EC:2.4.1.12))

Transcript

1562 bp

>Os03t0808100-03 Similar to Cellulose synthase BoCesA5.
AGGTTCTGGATTTGATGATGAGAAATCACTACTGATGTCTCAAATGAGCTTAGAGAAAAG
ATTTGGTCAATCTAGTGTTTTTGTAGCCTCCACTCTGATGGAATATGGTGGTGTTCCTCA
ATCCGCAACTCCAGAATCTCTTCTGAAAGAGGCCATACATGTTATCAGCTGTGGCTATGA
AGACAAAAGTGACTGGGGAACTGAGAttggatggatctatggttctgttacagaagatat
tctcactggattcaagatgcatgcacgtggctggcggtcaatctactgcatgcctaagcg
accagcattcaaggggtctgccccaattaatctttcggatcgtctgaaccaggtgcttcg
gtgggctcttggttctgtggaaattctttttagcaggcattgtcccatatggtatgggta
cggaggacggcttaagttcctggagagatttgcttacatcaacaccactatttatccact
cacatcgattccactcctcttgtactgcatattgccagctatctgtcttctcactgggaa
gttcatcataccagagattagcaactttgcgagtatttggtttatctctctctttctgtc
aatctttgctactggtatccttgagatgaggtggagtggtgttggcatcgatgaatggtg
gaggaatgagcagttttgggttattggaggtatttccgctcatctatttgcggtcttcca
gggtctgctgaaggtgcttgctggaattgataccagcttcactgtcacctcaaaggcctc
tgatgaagaaggcgatttcgctgagctctacatgttcaagtggacaacccttctgatccc
accgaccactattttgatcatcaacctggtcggtgttgttgctggtatctcctacgctat
caacagtggctaccagtcatggggtccgctctttgggaagctcttctttgccttctgggt
gattgtccacctgtaccccttccttaagggtctcatgggtcggcagaaccgtacaccgac
cattgttgttgtttgggccatcctccttgcatcgatcttctccttgctgtgggtTCGTAT
CGATCCATTCACCACCCGTGTCACAGGCCCTGATACCCAAAAATGTGGTATCAACTGCTA
GGAGTGAGCAAGATAGTAGGCAAAGAATCGCCAGTTTGCTATCCATTCTGTTGTGTAAGT
TATTAGTGGATGACTCTATATAGTCTACTGTAAGATCTTAGCTGCCGGAATGCTTGTTAT
GTATTAAGGAGTAGTAAGTGGTACCTTGCTGTTCATCTGTTGATAATTAAGTTAGTAGAA
CTACTTTGCTGAAAAATGCCTGACAACATTCTGCTGCACTTAATGGGAATATGAAATCAA
TGTTGCTCTGTATGAAAGAATTTACATGTATATAACTTGAATCAATTTAACAAATACACT
CTGTAGCCTTGTAGGCACACTGCATTGCAGGTTCCTGGTAGAAACCCCAATGAGTGTATG
CACAATGTATGCATAAATATGACTGATTCCTTCTGAATTTTTTTATACACACTTTATACA
GT

CDS

1140 bp

>Os03t0808100-03 Similar to Cellulose synthase BoCesA5.
GGTTCTGGATTTGATGATGAGAAATCACTACTGATGTCTCAAATGAGCTTAGAGAAAAGA
TTTGGTCAATCTAGTGTTTTTGTAGCCTCCACTCTGATGGAATATGGTGGTGTTCCTCAA
TCCGCAACTCCAGAATCTCTTCTGAAAGAGGCCATACATGTTATCAGCTGTGGCTATGAA
GACAAAAGTGACTGGGGAACTGAGAttggatggatctatggttctgttacagaagatatt
ctcactggattcaagatgcatgcacgtggctggcggtcaatctactgcatgcctaagcga
ccagcattcaaggggtctgccccaattaatctttcggatcgtctgaaccaggtgcttcgg
tgggctcttggttctgtggaaattctttttagcaggcattgtcccatatggtatgggtac
ggaggacggcttaagttcctggagagatttgcttacatcaacaccactatttatccactc
acatcgattccactcctcttgtactgcatattgccagctatctgtcttctcactgggaag
ttcatcataccagagattagcaactttgcgagtatttggtttatctctctctttctgtca
atctttgctactggtatccttgagatgaggtggagtggtgttggcatcgatgaatggtgg
aggaatgagcagttttgggttattggaggtatttccgctcatctatttgcggtcttccag
ggtctgctgaaggtgcttgctggaattgataccagcttcactgtcacctcaaaggcctct
gatgaagaaggcgatttcgctgagctctacatgttcaagtggacaacccttctgatccca
ccgaccactattttgatcatcaacctggtcggtgttgttgctggtatctcctacgctatc
aacagtggctaccagtcatggggtccgctctttgggaagctcttctttgccttctgggtg
attgtccacctgtaccccttccttaagggtctcatgggtcggcagaaccgtacaccgacc
attgttgttgtttgggccatcctccttgcatcgatcttctccttgctgtgggtTCGTATC
GATCCATTCACCACCCGTGTCACAGGCCCTGATACCCAAAAATGTGGTATCAACTGCTAG

Protein

379 aa

>Os03t0808100-03 Similar to Cellulose synthase BoCesA5.
GSGFDDEKSLLMSQMSLEKRFGQSSVFVASTLMEYGGVPQSATPESLLKEAIHVISCGYE
DKSDWGTEIGWIYGSVTEDILTGFKMHARGWRSIYCMPKRPAFKGSAPINLSDRLNQVLR
WALGSVEILFSRHCPIWYGYGGRLKFLERFAYINTTIYPLTSIPLLLYCILPAICLLTGK
FIIPEISNFASIWFISLFLSIFATGILEMRWSGVGIDEWWRNEQFWVIGGISAHLFAVFQ
GLLKVLAGIDTSFTVTSKASDEEGDFAELYMFKWTTLLIPPTTILIINLVGVVAGISYAI
NSGYQSWGPLFGKLFFAFWVIVHLYPFLKGLMGRQNRTPTIVVVWAILLASIFSLLWVRI
DPFTTRVTGPDTQKCGINC*

5'UTR

chr03:33782264..33782264 (- strand) : 1 bp

CDS

chr03:33782060..33782263 (- strand) : 204 bp

chr03:33781466..33781816 (- strand) : 351 bp

chr03:33780799..33781383 (- strand) : 585 bp

3'UTR

chr03:33780378..33780798 (- strand) : 421 bp

FASTA

>Os03t0808100-03 class=Sequence position=chr03:33780378..33782264 (- strand)
AGGTTCTGGA TTTGATGATG AGAAATCACT ACTGATGTCT CAAATGAGCT TAGAGAAAAG ATTTGGTCAA TCTAGTGTTT
TTGTAGCCTC CACTCTGATG GAATATGGTG GTGTTCCTCA ATCCGCAACT CCAGAATCTC TTCTGAAAGA GGCCATACAT
GTTATCAGCT GTGGCTATGA AGACAAAAGT GACTGGGGAA CTGAGGTAAT AAAGCTATGG CATTCATGCT CTGCATTACA
TGCTACTAGC CTACCAGTAC AAATTATACA ATGTAACAGA AAATGTCGAG ATATCAAGTG GTCTTTCTTG TACAAAATTA
AGGACGCAAT TTGATTTCTG TTCTGATTCG CACAAGTACT TCTGAGTTCA TGCGAAGAAA CTTGACTAAA TTGGCATCTC
CTCTCAGTTG CCATTATAAC TTTGTTTATG ATGCTATGTG ACTTGCAGAt tggatggatc tatggttctg ttacagaaga
tattctcact ggattcaaga tgcatgcacg tggctggcgg tcaatctact gcatgcctaa gcgaccagca ttcaaggggt
ctgccccaat taatctttcg gatcgtctga accaggtgct tcggtgggct cttggttctg tggaaattct ttttagcagg
cattgtccca tatggtatgg gtacggagga cggcttaagt tcctggagag atttgcttac atcaacacca ctatttatcc
actcacatcg attccactcc tcttgtactg catattgcca gctatctgtc ttctcactgg gaagttcatc ataccagagg
taaatatgta gaattgtttt tcctcttctg cagacgaaat cgcagaacag catgcgctga ctgacttatt ttggactgca
gattagcaac tttgcgagta tttggtttat ctctctcttt ctgtcaatct ttgctactgg tatccttgag atgaggtgga
gtggtgttgg catcgatgaa tggtggagga atgagcagtt ttgggttatt ggaggtattt ccgctcatct atttgcggtc
ttccagggtc tgctgaaggt gcttgctgga attgatacca gcttcactgt cacctcaaag gcctctgatg aagaaggcga
tttcgctgag ctctacatgt tcaagtggac aacccttctg atcccaccga ccactatttt gatcatcaac ctggtcggtg
ttgttgctgg tatctcctac gctatcaaca gtggctacca gtcatggggt ccgctctttg ggaagctctt ctttgccttc
tgggtgattg tccacctgta ccccttcctt aagggtctca tgggtcggca gaaccgtaca ccgaccattg ttgttgtttg
ggccatcctc cttgcatcga tcttctcctt gctgtgggtT CGTATCGATC CATTCACCAC CCGTGTCACA GGCCCTGATA
CCCAAAAATG TGGTATCAAC TGCTAGGAGT GAGCAAGATA GTAGGCAAAG AATCGCCAGT TTGCTATCCA TTCTGTTGTG
TAAGTTATTA GTGGATGACT CTATATAGTC TACTGTAAGA TCTTAGCTGC CGGAATGCTT GTTATGTATT AAGGAGTAGT
AAGTGGTACC TTGCTGTTCA TCTGTTGATA ATTAAGTTAG TAGAACTACT TTGCTGAAAA ATGCCTGACA ACATTCTGCT
GCACTTAATG GGAATATGAA ATCAATGTTG CTCTGTATGA AAGAATTTAC ATGTATATAA CTTGAATCAA TTTAACAAAT
ACACTCTGTA GCCTTGTAGG CACACTGCAT TGCAGGTTCC TGGTAGAAAC CCCAATGAGT GTATGCACAA TGTATGCATA
AATATGACTG ATTCCTTCTG AATTTTTTTA TACACACTTT ATACAGT

Locus: Os03g0808100

Loading...

Locus: Os03g0808100

Loading...