Os03t0808500-00

Locus

Os03g0808500

Description

Plant lipid transfer protein/Par allergen family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.3, OsLtpI.3

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.3, lipid transfer protein 1.3, type 1 non-specific lipid transfer protein 3

Transcript Evidence

CT835148 (DDBJ, Best hit)

Protein Evidence

Q5NE32 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Expression Databases

TENOR (Os03t0808500-00)

Others

Oryzabase (13512)

KEGG (Os03t0808500-00)

Transcript

654 bp

>Os03t0808500-00 Plant lipid transfer protein/Par allergen family protein.
GCACTCACACACACACTCACACGCAACGCGTTTGTTCAATCGATCGGCCGTCACCGCGAG
CGCACGATGGCGAGCGCTCGTCGCAGCCGCGGCGTGGCGGCGGTGGGGATCGCGGTGTTT
GTGGCTGTCGTGGTGGTGGCGGCGGGCGCCGGGGGCGCGGCGGCGGTGTCGTGCGGCGAC
GCGGTGAGCGCGCTGGCGCCGTGCGGGCCGTTCCTGCTGGGCGGCGCGGCGCGGCCGGGC
GATCGGTGCTGCGGCGGCGCGAGGGCGCTGCGCGGGATGGCGGGCACGGCGGAGGCGCGG
CGCGCGCTGTGCAGGTGCCTGGAGCAGTCCGGGCCGTCGTTCGGCGTGCTCCCCGACCGC
GCGCGGCGCCTCCCGGCGCTCTGCAAGCTCGGACTCGCCATCCCCGTCGGCGCCGCCACC
GACTGCAGCAAGATATCCTAAGTGGCAGCGGCGGCGACGACGACGCCGCTACATGGCGTG
AGTTCGTCGCGATCGGTGCATGATCGAACATGCATGGTGTTGACGCGGGAGAAGAGTGAT
TTGGCTTTTGCGCATGGTGTAATCTGATCTGATCTAATCCGTGCATGAATAAGTACTAGA
CATGCTTGTAATAACTCATGAGCTAAATATCACTCAGATGAGATCTCAGATTTG

CDS

375 bp

>Os03t0808500-00 Plant lipid transfer protein/Par allergen family protein.
ATGGCGAGCGCTCGTCGCAGCCGCGGCGTGGCGGCGGTGGGGATCGCGGTGTTTGTGGCT
GTCGTGGTGGTGGCGGCGGGCGCCGGGGGCGCGGCGGCGGTGTCGTGCGGCGACGCGGTG
AGCGCGCTGGCGCCGTGCGGGCCGTTCCTGCTGGGCGGCGCGGCGCGGCCGGGCGATCGG
TGCTGCGGCGGCGCGAGGGCGCTGCGCGGGATGGCGGGCACGGCGGAGGCGCGGCGCGCG
CTGTGCAGGTGCCTGGAGCAGTCCGGGCCGTCGTTCGGCGTGCTCCCCGACCGCGCGCGG
CGCCTCCCGGCGCTCTGCAAGCTCGGACTCGCCATCCCCGTCGGCGCCGCCACCGACTGC
AGCAAGATATCCTAA

Protein

125 aa

>Os03t0808500-00 Plant lipid transfer protein/Par allergen family protein.
MASARRSRGVAAVGIAVFVAVVVVAAGAGGAAAVSCGDAVSALAPCGPFLLGGAARPGDR
CCGGARALRGMAGTAEARRALCRCLEQSGPSFGVLPDRARRLPALCKLGLAIPVGAATDC
SKIS*

5'UTR

chr03:33798940..33799005 (+ strand) : 66 bp

CDS

chr03:33799006..33799370 (+ strand) : 365 bp

chr03:33799465..33799474 (+ strand) : 10 bp

3'UTR

chr03:33799475..33799687 (+ strand) : 213 bp

FASTA

>Os03t0808500-00 class=Sequence position=chr03:33798940..33799687 (+ strand)
GCACTCACAC ACACACTCAC ACGCAACGCG TTTGTTCAAT CGATCGGCCG TCACCGCGAG CGCACGATGG CGAGCGCTCG
TCGCAGCCGC GGCGTGGCGG CGGTGGGGAT CGCGGTGTTT GTGGCTGTCG TGGTGGTGGC GGCGGGCGCC GGGGGCGCGG
CGGCGGTGTC GTGCGGCGAC GCGGTGAGCG CGCTGGCGCC GTGCGGGCCG TTCCTGCTGG GCGGCGCGGC GCGGCCGGGC
GATCGGTGCT GCGGCGGCGC GAGGGCGCTG CGCGGGATGG CGGGCACGGC GGAGGCGCGG CGCGCGCTGT GCAGGTGCCT
GGAGCAGTCC GGGCCGTCGT TCGGCGTGCT CCCCGACCGC GCGCGGCGCC TCCCGGCGCT CTGCAAGCTC GGACTCGCCA
TCCCCGTCGG CGCCGCCACC GACTGCAGCA AGTAATAATT AAAAAAAAGT TGATTAGATT GGTCTCATGG CGCATTAGTT
TGCATTTACT GAATTGTTTG TTCATCTCGG TTCGATCCAT TGCAGGATAT CCTAAGTGGC AGCGGCGGCG ACGACGACGC
CGCTACATGG CGTGAGTTCG TCGCGATCGG TGCATGATCG AACATGCATG GTGTTGACGC GGGAGAAGAG TGATTTGGCT
TTTGCGCATG GTGTAATCTG ATCTGATCTA ATCCGTGCAT GAATAAGTAC TAGACATGCT TGTAATAACT CATGAGCTAA
ATATCACTCA GATGAGATCT CAGATTTG

Locus: Os03g0808500

Loading...

Locus: Os03g0808500

Loading...