Os03t0810800-01

Locus

Os03g0810800

Description

Short-chain alcohol dehydrogenase, ABA biosynthesis, Lesion mimic formation, Disease-resistance, Seed dormancy

RAP-DB Gene Symbol Synonym(s)

OsABA2

RAP-DB Gene Name Synonym(s)

Abscisic Acid2

CGSNL Gene Symbol

ABA2

CGSNL Gene Name

ABA DEFICIENT 2

Oryzabase Gene Symbol Synonym(s)

OsABA2, OsSDR, SDR

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK070201

Protein Evidence

Q7XZH5

Literature

PMID: 29643863

Note

Manual Curation

April 17, 2018

Functional domain (InterPro)

NAD(P)-binding domain superfamily (IPR036291)

Short-chain dehydrogenase/reductase SDR (IPR002347)

Full-length cDNA

J023042C15 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0810800-01)

Others

Oryzabase (18179)

Transcript

1169 bp

>Os03t0810800-01 Short-chain alcohol dehydrogenase, ABA biosynthesis, Lesion mimic formation, Disease-resistance, Seed dormancy
ACACACACACTAGTGCAAGCAGCTCGAGCTTGAGCTCCACCTCGCCATCGCCGGCGACTT
CTCCTGTCCTGACCGGCCGGAGCTCCGATCTTGGCGGTGACCAAGAGACCTGACGAGACG
ATGTCCGCCGCCGCCGCCGCCGCCGCATCCTCCCCCGCTCCCCGGTTGGAAAGCAAGGTT
GCGCTGGTTACCGGTGGTGCTTCAGGTATTGGTGAAGCAATTGTTCGCCTCTTTAGAGAG
CATGGTGCAAAGGTATGTATTGCAGATATCCAAGATGAAGCAGGTCAGAAGCTCCGGGAC
TCCCTTGGAGGTGACCAAGATGTCTTATTTGTCCACTGCGATGTTTCGGTGGAAGAGGAT
GTAGCCCGAGCGGTCGATGCAACAGCTGAAAAGTTTGGTACTCTTGACATCATGGTCAAC
AATGCTGGCTTTACAGGCCAGAAAATCACAGATATCCGAAACATCGACTTTTCTGAAGTC
AGGAAGGTAATCGACATCAATTTAGTTGGTGTATTCCACGGGATGAAACACGCAGCGCGC
ATCATGATCCCCAATAAGAAGGGGTCCATCATCTCATTGGGAAGTGTTTCTAGTGTCATT
GGAGGGTTGGGACCTCATTCATACACAGCAACCAAGCATGCTGTGGTGGGTCTAACCAAG
AATGTAGCTGGGGAATTGGGGAAGCATGGGATACGCGTGAACTGCGTATCTCCCTATGCA
GTGCCCACGGCTCTCTCCATGCCGTATCTGCCCCAGGGCGAGCGCAAGGATGATGCCCTG
AAAGACTTTTTCGCCTTTGTTGGTGGTGAAGCAAACCTGAAAGGTGTGGATCTGCTACCT
AAGGATGTTGCTCAAGCAGTGCTCTACTTGGCAAGCGATGAAGCGAGGTACATCAGCGCG
CTCAACCTCATGGTGGATGGTGGCTTTACCTCTGTGAATCACAATTTGAGAGCATTTGAA
GATTAACAGAAGTTGTTAGGCACAATTGGTACTCTAGTTTCAGATGCTATGTACCATTCT
GATTTTAGAACTTTGATCAATTACCTAAAGTAAGAATGTCAATAAGGAATGCAATCTTGT
ATCTGTGGTATTGTATAGTACTATGATTGTATTGCCGGTGCTTAAGGACAATCATTGATT
ATTATCAGCACTATTATGTTACAGTTCTG

CDS

846 bp

>Os03t0810800-01 Short-chain alcohol dehydrogenase, ABA biosynthesis, Lesion mimic formation, Disease-resistance, Seed dormancy
ATGTCCGCCGCCGCCGCCGCCGCCGCATCCTCCCCCGCTCCCCGGTTGGAAAGCAAGGTT
GCGCTGGTTACCGGTGGTGCTTCAGGTATTGGTGAAGCAATTGTTCGCCTCTTTAGAGAG
CATGGTGCAAAGGTATGTATTGCAGATATCCAAGATGAAGCAGGTCAGAAGCTCCGGGAC
TCCCTTGGAGGTGACCAAGATGTCTTATTTGTCCACTGCGATGTTTCGGTGGAAGAGGAT
GTAGCCCGAGCGGTCGATGCAACAGCTGAAAAGTTTGGTACTCTTGACATCATGGTCAAC
AATGCTGGCTTTACAGGCCAGAAAATCACAGATATCCGAAACATCGACTTTTCTGAAGTC
AGGAAGGTAATCGACATCAATTTAGTTGGTGTATTCCACGGGATGAAACACGCAGCGCGC
ATCATGATCCCCAATAAGAAGGGGTCCATCATCTCATTGGGAAGTGTTTCTAGTGTCATT
GGAGGGTTGGGACCTCATTCATACACAGCAACCAAGCATGCTGTGGTGGGTCTAACCAAG
AATGTAGCTGGGGAATTGGGGAAGCATGGGATACGCGTGAACTGCGTATCTCCCTATGCA
GTGCCCACGGCTCTCTCCATGCCGTATCTGCCCCAGGGCGAGCGCAAGGATGATGCCCTG
AAAGACTTTTTCGCCTTTGTTGGTGGTGAAGCAAACCTGAAAGGTGTGGATCTGCTACCT
AAGGATGTTGCTCAAGCAGTGCTCTACTTGGCAAGCGATGAAGCGAGGTACATCAGCGCG
CTCAACCTCATGGTGGATGGTGGCTTTACCTCTGTGAATCACAATTTGAGAGCATTTGAA
GATTAA

Protein

282 aa

>Os03t0810800-01 Short-chain alcohol dehydrogenase, ABA biosynthesis, Lesion mimic formation, Disease-resistance, Seed dormancy
MSAAAAAAASSPAPRLESKVALVTGGASGIGEAIVRLFREHGAKVCIADIQDEAGQKLRD
SLGGDQDVLFVHCDVSVEEDVARAVDATAEKFGTLDIMVNNAGFTGQKITDIRNIDFSEV
RKVIDINLVGVFHGMKHAARIMIPNKKGSIISLGSVSSVIGGLGPHSYTATKHAVVGLTK
NVAGELGKHGIRVNCVSPYAVPTALSMPYLPQGERKDDALKDFFAFVGGEANLKGVDLLP
KDVAQAVLYLASDEARYISALNLMVDGGFTSVNHNLRAFED*

5'UTR

chr03:33938998..33939117 (+ strand) : 120 bp

CDS

chr03:33939118..33939161 (+ strand) : 44 bp

chr03:33940319..33941120 (+ strand) : 802 bp

3'UTR

chr03:33941121..33941323 (+ strand) : 203 bp

FASTA

>Os03t0810800-01 class=Sequence position=chr03:33938998..33941323 (+ strand)
ACACACACAC TAGTGCAAGC AGCTCGAGCT TGAGCTCCAC CTCGCCATCG CCGGCGACTT CTCCTGTCCT GACCGGCCGG
AGCTCCGATC TTGGCGGTGA CCAAGAGACC TGACGAGACG ATGTCCGCCG CCGCCGCCGC CGCCGCATCC TCCCCCGCTC
CCCGGTACGT ACCTGGTTCT GGTCGCCGTA ATCCGATCTC CTCTTTTTTT TTTTCGCACG GTCTTCACCG GCGGCGCTGT
ATGTTAGTTT ACTCGATCTC GAATCCCCGA TGCGTCGCCG CCGGTGAAGG TCCCGGGCTT TCGCCGTTTG CCATGGCGAA
ATCGAGGGAT CTGACTGACT GACTGACTGT CCCTATCCCC TTCCCAGTAA GAGTGGGCTG CTCAACTGAT AGGTTTTGGT
GTGAGAGTGT TTGGGGCTTC TTCAGATTGC CCAGAGGAAA CCCCATATGT TCTTGAACTG AAAAGATGAA TGGGGAATCT
CAATGTTAGT CAAAGGGGGA ATTAGTTTCT AATTTTCCCT TCAATAACAT GTTAGCTGGT GTGTCAAGTC CTGTAATTTG
TGAATTGTGA GAGTTCAGGC TAGCAAGATT AAGCTTGTAT TTTGTTAGAA ATAATGTGGT TAAAAATCAT GTTTGGGTGG
TTTTATGAGA AAAAAACTGA AAACATTGTT CGCGAACAAG CAAGTAAACA ACTTTGCAAT GGTGCTTGCC TGGTCTTTCC
TCAACTAGGA TAATGTTCTT TTCAAGTTAA TTAGCTGTCG CAACTCACTA GTAGAAGTGC CTATAGAATT TAATCAaaac
ggcggctcac ttatccttcc tctgcccctt cgcaactgca ttctggaatc agcttgaaat cccgcagact atcaccagcg
cgagcgacct ccatgctctg cgcccaaatg gccgcctccc aacaaaacac ttcaaggttt tcttcttgct ttgtctctgg
ggattatgga atcatcgtta tgatgttgtc ttccgtggag aatccccctc tctgcataga ctagtttcta gatgtattga
ggatgcaacc ttgtgggcag agagactagt ttgtgctgac aggatcgttg taatcctgga aacaaattct ttcctccccc
cttcgcacta tgtaatccaa agtcgtgtac tcctatcttt caatgaaaat tcaggtgggg aagctctccc ccccggtgac
cagtctaaaa aaaataattt aatcaatggt tcatgaaacA CTGGTAATTC TGATACTAAA TACAATTTGC ATATTTATCA
GTTCTTTAAA TTTGATTTGG GTTCTTTCCT CTGGAGAAAA GGTTGGAAAG CAAGGTTGCG CTGGTTACCG GTGGTGCTTC
AGGTATTGGT GAAGCAATTG TTCGCCTCTT TAGAGAGCAT GGTGCAAAGG TATGTATTGC AGATATCCAA GATGAAGCAG
GTCAGAAGCT CCGGGACTCC CTTGGAGGTG ACCAAGATGT CTTATTTGTC CACTGCGATG TTTCGGTGGA AGAGGATGTA
GCCCGAGCGG TCGATGCAAC AGCTGAAAAG TTTGGTACTC TTGACATCAT GGTCAACAAT GCTGGCTTTA CAGGCCAGAA
AATCACAGAT ATCCGAAACA TCGACTTTTC TGAAGTCAGG AAGGTAATCG ACATCAATTT AGTTGGTGTA TTCCACGGGA
TGAAACACGC AGCGCGCATC ATGATCCCCA ATAAGAAGGG GTCCATCATC TCATTGGGAA GTGTTTCTAG TGTCATTGGA
GGGTTGGGAC CTCATTCATA CACAGCAACC AAGCATGCTG TGGTGGGTCT AACCAAGAAT GTAGCTGGGG AATTGGGGAA
GCATGGGATA CGCGTGAACT GCGTATCTCC CTATGCAGTG CCCACGGCTC TCTCCATGCC GTATCTGCCC CAGGGCGAGC
GCAAGGATGA TGCCCTGAAA GACTTTTTCG CCTTTGTTGG TGGTGAAGCA AACCTGAAAG GTGTGGATCT GCTACCTAAG
GATGTTGCTC AAGCAGTGCT CTACTTGGCA AGCGATGAAG CGAGGTACAT CAGCGCGCTC AACCTCATGG TGGATGGTGG
CTTTACCTCT GTGAATCACA ATTTGAGAGC ATTTGAAGAT TAACAGAAGT TGTTAGGCAC AATTGGTACT CTAGTTTCAG
ATGCTATGTA CCATTCTGAT TTTAGAACTT TGATCAATTA CCTAAAGTAA GAATGTCAAT AAGGAATGCA ATCTTGTATC
TGTGGTATTG TATAGTACTA TGATTGTATT GCCGGTGCTT AAGGACAATC ATTGATTATT ATCAGCACTA TTATGTTACA
GTTCTG

Locus: Os03g0810800

Loading...

Locus: Os03g0810800

Loading...