Os03t0811600-01

Locus

Os03g0811600

Description

Similar to Peptidyl prolyl isomerase H.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP22

CGSNL Gene Name

CYCLOPHILIN 22

Oryzabase Gene Symbol Synonym(s)

OsCYP22, OsCYP-10

Oryzabase Gene Name Synonym(s)

cyclophilin 22, cyclophilin 10

Transcript Evidence

AK071076 (DDBJ, Best hit)

Protein Evidence

Q1KL26 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type, conserved site (IPR020892)

Full-length cDNA

J023078H22 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0811600-01)

RiceXPro (AK071076)

Others

Oryzabase (10064)

KEGG (Os03t0811600-01 (EC:5.2.1.8))

Transcript

1026 bp

>Os03t0811600-01 Similar to Peptidyl prolyl isomerase H.
GCCGTCGCCGCCGCCTCCGCCGCGTGCGAAGCTTGGAGAGTTCGAGCACGGGCATGGCGT
CCTCGGGGGGAGCGGCGATCTCGGCGGGGCCCACGCCGCCGTCGGCGGCGGCGGCGTCGT
CGTCGGTGGACTGGCACCTGCGGCCGCCGAACCCGAAGAACCCGGTGGTGTTCTTCGACG
TGACCATCGGGTCCATCCCCGCCGGCCGCATCAAGATGGAGCTCTTCGCCGACATCGTCC
CCAAGACGGCGGAGAACTTCCGGCAGTTCTGCACTGGAGAGCACAGGAAATCAGGTTTAC
CACAGGGATATAAGGGTTGTCAGTTCCATCGAGTGATCAAAGATTTCATGATTCAGGGAG
GTGACTATATGAAGGGGGATGGTACTGGATGCACGTCAATCTATGGTACCAAATTTGATG
ATGAAAACTTCATTGCAAAGCATACTGGTCCTGGCCTACTTTCTATGGCAAATAGTGGGG
TGAACTCTAATGGATCTCAGTTCTTTATAACTTGTGCAAAATGTGAATGGCTGGACAACA
AGCATGTGGTTTTTGGGAGGGTGCTAGGGGATGGTATGCTTGCTGTGCGGAAGATCGAGA
ATGTTGCAACTGGACCAAACAACCGACCGAAGCTCGCATGTGTCATAAGCGAGTGTGGTG
AGATGTAGTTTGTACCTTGAGGGTGACTATTCTTGGTGCTGCTGATGTAGAAATAGACTT
TGCATGGATGAAACTACTCCAGCATTGGAAGCACCATAAGACATAGCTGTACCAAAGTAT
CAATTCACCTTGAATGAGTGTCTGTCTATACACTGATGAAAGTTCATCCTCACTTCGTCA
GTGACATCAGTTGTCACTTAAACTGTTGATTAATATTCTAAACAGGGAATATGTGTGTCT
GTTCGACTTGAACCTTCGTCATGTCAAGTGGAGCTGGCATTATATTCAGCTGAACATGCT
TGATGAAATGATGAGTCGATCTGTGGTTGCACCCATTTTATAAAGTATACTAAACTATAA
GCTGCC

CDS

615 bp

>Os03t0811600-01 Similar to Peptidyl prolyl isomerase H.
ATGGCGTCCTCGGGGGGAGCGGCGATCTCGGCGGGGCCCACGCCGCCGTCGGCGGCGGCG
GCGTCGTCGTCGGTGGACTGGCACCTGCGGCCGCCGAACCCGAAGAACCCGGTGGTGTTC
TTCGACGTGACCATCGGGTCCATCCCCGCCGGCCGCATCAAGATGGAGCTCTTCGCCGAC
ATCGTCCCCAAGACGGCGGAGAACTTCCGGCAGTTCTGCACTGGAGAGCACAGGAAATCA
GGTTTACCACAGGGATATAAGGGTTGTCAGTTCCATCGAGTGATCAAAGATTTCATGATT
CAGGGAGGTGACTATATGAAGGGGGATGGTACTGGATGCACGTCAATCTATGGTACCAAA
TTTGATGATGAAAACTTCATTGCAAAGCATACTGGTCCTGGCCTACTTTCTATGGCAAAT
AGTGGGGTGAACTCTAATGGATCTCAGTTCTTTATAACTTGTGCAAAATGTGAATGGCTG
GACAACAAGCATGTGGTTTTTGGGAGGGTGCTAGGGGATGGTATGCTTGCTGTGCGGAAG
ATCGAGAATGTTGCAACTGGACCAAACAACCGACCGAAGCTCGCATGTGTCATAAGCGAG
TGTGGTGAGATGTAG

Protein

205 aa

>Os03t0811600-01 Similar to Peptidyl prolyl isomerase H.
MASSGGAAISAGPTPPSAAAASSSVDWHLRPPNPKNPVVFFDVTIGSIPAGRIKMELFAD
IVPKTAENFRQFCTGEHRKSGLPQGYKGCQFHRVIKDFMIQGGDYMKGDGTGCTSIYGTK
FDDENFIAKHTGPGLLSMANSGVNSNGSQFFITCAKCEWLDNKHVVFGRVLGDGMLAVRK
IENVATGPNNRPKLACVISECGEM*

5'UTR

chr03:33998579..33998631 (- strand) : 53 bp

CDS

chr03:33998370..33998578 (- strand) : 209 bp

chr03:33998226..33998249 (- strand) : 24 bp

chr03:33997722..33997809 (- strand) : 88 bp

chr03:33997382..33997474 (- strand) : 93 bp

chr03:33996666..33996698 (- strand) : 33 bp

chr03:33996410..33996466 (- strand) : 57 bp

chr03:33995991..33996101 (- strand) : 111 bp

3'UTR

chr03:33995633..33995990 (- strand) : 358 bp

FASTA

>Os03t0811600-01 class=Sequence position=chr03:33995633..33998631 (- strand)
GCCGTCGCCG CCGCCTCCGC CGCGTGCGAA GCTTGGAGAG TTCGAGCACG GGCATGGCGT CCTCGGGGGG AGCGGCGATC
TCGGCGGGGC CCACGCCGCC GTCGGCGGCG GCGGCGTCGT CGTCGGTGGA CTGGCACCTG CGGCCGCCGA ACCCGAAGAA
CCCGGTGGTG TTCTTCGACG TGACCATCGG GTCCATCCCC GCCGGCCGCA TCAAGATGGA GCTCTTCGCC GACATCGTCC
CCAAGACGGC GGAGAACTTC CGGTACTGAC CCAGAGCCCT CGCTCGCCTT AAACCCTAGG TTCCATCTGT TTAATCCTGC
TTCTGATGTG TTTGCTTTTG ATGGATCTCA CTGATTTGTT TCATCTGTTT GTTTGGTTTC AGGCAGTTCT GCACTGGAGA
GCACAGGTAG GGAGGCCCGG CGATTGGTTG ATGGCTATGG CCAAGCATTT GTTGTTTATT CTTCAGCATT GACTGTCTTG
ACAGCTTTAA ATGTTTAGCT TTGTTTGACT ATGATATTGC CATAGAATTG CTTTATACTG TAGTAGTGGA TCTTCGATGA
AGATGGTGGG TAGCTAGGTT AGTATTGCTG ATACTGGTCG AGTAGCTTTT GGGCACAACT AAATTCCATT CTAATTTGAC
ATCTATTATA CCTCCATTGT CTGCGATTGT TGTAATTGGC AGGAAACTGA GCTTGCATTT TTTTTCAGAA CATTGATTAC
TTGATTATGT GATTTAGGCA AAAGTGCGCA AGCTTTCACC CACATATTGA ATTACTATCA CATCCATTGT TCAATCATAG
AAGCTTCATC ACTGGATTGC AGGAAATCAG GTTTACCACA GGGATATAAG GGTTGTCAGT TCCATCGAGT GATCAAAGAT
TTCATGATTC AGGGAGGTGA CTATATGAAG GTTCGTGTGC TAAATTTGCT TCAAGTGTCA ATCATGTCAC CTAGCATAAT
AGCTTTAATC TGGTGTTTTC ATAGGACTAA CTAACTAATC CTGTGGATTT ATAACAAAAG GCATCTACTA TTGCACACTT
TGATGTTATC TTTTATCAAG CATTGGGCAA TGAACTGTTA TTCAGCTATC TCCATACTTG GATTTGATTC ATGTGATATT
AAAAATAAAT TAAAGCACTC TGTTTTGATG TCCTAAGGGG GATGGTACTG GATGCACGTC AATCTATGGT ACCAAATTTG
ATGATGAAAA CTTCATTGCA AAGCATACTG GTCCTGGCCT ACTTTCTATG GTATTATTCC TCTCCACCTG ATTTTCAATT
GAAATACTGT TAGAAAATAT TACCTCTCTA ATGTAATCTT GTGCAGGACA ACTATTTCTA GTGTTTGGTG GTTTAGCTAT
GTTTGCAGAT AATTTCCTTG GACTCCTTGC TCTCTCTCTC TCTCTGTTAC AAATTCTTAG TTTTCATCTG TTAATGCCTT
CGGTGTGTGG CTTCTGGTCA TTGGGTAAGC AGAGCCTCTT GTGCTCTGGA AACCTGCAGA TAGTTGATAC ACAATTGTGC
GTAAAATGAG GTATCTGAAG TTAACTATCT AAATGTGGCA AATTGTTTTT ACACACAGTA TTTCCAATCT ACTCTTCCCA
ACGTTGAAAT TTGCATAGGT TAGGTCATAT TACATTTACA TCAAATTAGA ACAAGACATT GAAGCATCAT CAAAGGTCAT
TGTGATTGGT GACTGACCCA ATTGTATTGT TTACTTTTAG AACATTTGCC TGACCAAGTG ACCAACCGCC TTATGCTGTT
ATTAATCTAT ATTTTTATCT GTTTCGGTGT AACTAGCTAC TTCTACATCC ATTTTGTTTT TTAGAACTTT TATGTGCATG
TTTCCTGCAC TGCAAGACAG TAATTTGATT TATTTTAGAT GATATATTTG GTTTTATTTT CTAGATGTAA AAAACTGTCC
TATCTTTTTT CAGGCAAATA GTGGGGTGAA CTCTAATGGA TCTCAGGTAC TTCTTTTGAT AACTGCTCTA TTTTTTTTCT
GTGTGGCTGT AGATTTTTTA TCCAGCTGGT TTTGCAATCT TCGGGCTGGG GTACTGTTTT GGGATTGTAT TTTGTTCTCT
ATACAAAATT AGCAATATCC AGTTCCAGGT TTCTTTTCAG TTACAGTATT CCTGAAAATA TTATCTTCTA TTCTTATGCT
TGCAGTTCTT TATAACTTGT GCAAAATGTG AATGGCTGGA CAACAAGCAT GTGGTTTTTG GGGTAAGTTC CCTCATTTTG
AATGCTTTGT GCTCTCGGAG CAACATTCCA ACAGCATGTA CTTGTCTACA GTATGTTTTT TTACTTACAG AGTAAATATA
TGCCTGGTAA CATGAAAAAA GTTTAGTCGC TTTACTTTTG AGATTATGGA AAAACGGCTT GCCCCAGTAG AAAAAATGTG
TTTGAATGGT TCTTAGCAGT CATGTGCTAG TCTCAGGCTA GGTGGTGTTT TTACCTATTA CTACGTACCA TGTTAACCTA
CCACCATTCT AATTGAAATA ACTCTCTATT GTCATGTTAA ATCATTTCAG AGGGTGCTAG GGGATGGTAT GCTTGCTGTG
CGGAAGATCG AGAATGTTGC AACTGGACCA AACAACCGAC CGAAGCTCGC ATGTGTCATA AGCGAGTGTG GTGAGATGTA
GTTTGTACCT TGAGGGTGAC TATTCTTGGT GCTGCTGATG TAGAAATAGA CTTTGCATGG ATGAAACTAC TCCAGCATTG
GAAGCACCAT AAGACATAGC TGTACCAAAG TATCAATTCA CCTTGAATGA GTGTCTGTCT ATACACTGAT GAAAGTTCAT
CCTCACTTCG TCAGTGACAT CAGTTGTCAC TTAAACTGTT GATTAATATT CTAAACAGGG AATATGTGTG TCTGTTCGAC
TTGAACCTTC GTCATGTCAA GTGGAGCTGG CATTATATTC AGCTGAACAT GCTTGATGAA ATGATGAGTC GATCTGTGGT
TGCACCCATT TTATAAAGTA TACTAAACTA TAAGCTGCC

Locus: Os03g0811600

Loading...

Locus: Os03g0811600

Loading...