Os03t0815100-01

Locus

Os03g0815100

Description

Similar to OsNAC6 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

SNAC1, snac1, OsNAC9, ONAC002, ONAC2, ONAC033, ONAC33, ONAC043, ONAC43, ONAC044, ONAC44, OsNAC19, NAC19, SNAC1/ONAC002, OsSNAC1

Oryzabase Gene Name Synonym(s)

SNAC1: stress-responsive NAC1, stress-responsive NAC 1, stress-induced transcription factor NAC1, NAC domain protein 9, NAC domain-containing protein 2, NAC domain-containing protein 33, NAC domain-containing protein 43, NAC domain-containing protein 44

Transcript Evidence

AK067690 (DDBJ, Best hit)

AK099245 (DDBJ, Best hit)

AK104551 (DDBJ, Best hit)

AK104712 (DDBJ, Best hit)

Protein Evidence

Q27JE5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J013120D02 (Online Clone Ordering)

J013116P10 (Online Clone Ordering)

006-305-E06 (Online Clone Ordering)

001-037-H04 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0815100-01)

Others

Oryzabase (6442)

Transcript

1293 bp

>Os03t0815100-01 Similar to OsNAC6 protein.
ATTCGAGAAATCCCTCACAACCCACAACATTTTCAAACAACGCAAAGCAGTAGCAGCAGC
GAGAAGCAAGCAAGAAGCGATGGGGATGGGGATgaggagggagagggacgcggaggcgga
gctgaacctgccgccggggttcaggttccaccccacggacgacgagctggtggagcacta
cctgtgcaggaaggcggcggggcagcgcctgccggtgccgatcatcgccgaggtggatct
ctacaagttcgacccgtgggatctgcccgAGCGCGCGCTGTTCGGCGCCAGGgagtggta
cttcttcaccccgcgggatcgcaagtatcctaatgggtcacgccccaaccgcgccgccgg
caacgggtactggaaggccaccggcgccgacaagcccgtcgcgccgcgggggcgcacgct
tgggatcaagaaggcgctcgtgttctacgccggcaaggcgccgcgaggggtcaagactga
ttggatcatgcatgagtaccggctCGCCGATGCTGGCCGCGCCGCCGCGGGCGCCAAGAA
GGGATCTCTCAGGTTGGATGATTGGGTGCTGTGTCGGCTGTACAACAAGAAGAACGAGTG
GGAGAAGATGCAGCAGGGGAAGGAGGTGAAGGAGGAGGCGTCCGACATGGTTACGTCGCA
GTCGCACTCGCACACCCACTCGTGGGGCGAGACGCGCACGCCGGAGTCGGAGATCGTGGA
CAACGACCCCTTCCCGGAGCTGGACTCGTTCCCGGCGTTCCAGCCTGCGCCGCCGCCGGC
GACGGCGATGATGGTGCCCAAGAAAGAATCGATGGACGACGCCACCGCGGCCGCCGCCGC
CGCCGCCACCATCCCCAGGAACAACAGCAGCCTGTTCGTGGACCTGAGCTACGACGATAT
CCAGGGCATGTACAGCGGCCTCGACATGCTGCCGCCGGGCGACGACTTCTACTCGTCGCT
CTTCGCGTCGCCGCGGGTGAAGGGGACGACGCCACGCGCCGGCGCCGGCATGGGCATGGT
CCCGTTCTGAGGTGACGGCGACGCGATCGAACAGGTGGTGATCGATGCTGCAACGTGTGT
AAATATACAGCGCCGGCTGGGTCAAGAGATGGCTCGGGTGACGCGCGCGCGGCGTGTCCT
GGCGTTGGCGCCGGGGCATTCTTTAGTTTTTCATCTTTTCATCATCTCAGATGGTAGATA
CAAAACAGTGTATGTATGTAGCTCTGTTTCTCTCTATAGAACCCCAACAAATTTTGTTGT
TGATGTTGTTTATCTTCATATGCTTTGATCTTG

CDS

951 bp

>Os03t0815100-01 Similar to OsNAC6 protein.
ATGGGGATGGGGATgaggagggagagggacgcggaggcggagctgaacctgccgccgggg
ttcaggttccaccccacggacgacgagctggtggagcactacctgtgcaggaaggcggcg
gggcagcgcctgccggtgccgatcatcgccgaggtggatctctacaagttcgacccgtgg
gatctgcccgAGCGCGCGCTGTTCGGCGCCAGGgagtggtacttcttcaccccgcgggat
cgcaagtatcctaatgggtcacgccccaaccgcgccgccggcaacgggtactggaaggcc
accggcgccgacaagcccgtcgcgccgcgggggcgcacgcttgggatcaagaaggcgctc
gtgttctacgccggcaaggcgccgcgaggggtcaagactgattggatcatgcatgagtac
cggctCGCCGATGCTGGCCGCGCCGCCGCGGGCGCCAAGAAGGGATCTCTCAGGTTGGAT
GATTGGGTGCTGTGTCGGCTGTACAACAAGAAGAACGAGTGGGAGAAGATGCAGCAGGGG
AAGGAGGTGAAGGAGGAGGCGTCCGACATGGTTACGTCGCAGTCGCACTCGCACACCCAC
TCGTGGGGCGAGACGCGCACGCCGGAGTCGGAGATCGTGGACAACGACCCCTTCCCGGAG
CTGGACTCGTTCCCGGCGTTCCAGCCTGCGCCGCCGCCGGCGACGGCGATGATGGTGCCC
AAGAAAGAATCGATGGACGACGCCACCGCGGCCGCCGCCGCCGCCGCCACCATCCCCAGG
AACAACAGCAGCCTGTTCGTGGACCTGAGCTACGACGATATCCAGGGCATGTACAGCGGC
CTCGACATGCTGCCGCCGGGCGACGACTTCTACTCGTCGCTCTTCGCGTCGCCGCGGGTG
AAGGGGACGACGCCACGCGCCGGCGCCGGCATGGGCATGGTCCCGTTCTGA

Protein

317 aa

>Os03t0815100-01 Similar to OsNAC6 protein.
MGMGMRRERDAEAELNLPPGFRFHPTDDELVEHYLCRKAAGQRLPVPIIAEVDLYKFDPW
DLPERALFGAREWYFFTPRDRKYPNGSRPNRAAGNGYWKATGADKPVAPRGRTLGIKKAL
VFYAGKAPRGVKTDWIMHEYRLADAGRAAAGAKKGSLRLDDWVLCRLYNKKNEWEKMQQG
KEVKEEASDMVTSQSHSHTHSWGETRTPESEIVDNDPFPELDSFPAFQPAPPPATAMMVP
KKESMDDATAAAAAAATIPRNNSSLFVDLSYDDIQGMYSGLDMLPPGDDFYSSLFASPRV
KGTTPRAGAGMGMVPF*

5'UTR

chr03:34166100..34166178 (+ strand) : 79 bp

CDS

chr03:34166179..34166652 (+ strand) : 474 bp

chr03:34166782..34167258 (+ strand) : 477 bp

3'UTR

chr03:34167259..34167521 (+ strand) : 263 bp

FASTA

>Os03t0815100-01 class=Sequence position=chr03:34166100..34167521 (+ strand)
ATTCGAGAAA TCCCTCACAA CCCACAACAT TTTCAAACAA CGCAAAGCAG TAGCAGCAGC GAGAAGCAAG CAAGAAGCGA
TGGGGATGGG GATgaggagg gagagggacg cggaggcgga gctgaacctg ccgccggggt tcaggttcca ccccacggac
gacgagctgg tggagcacta cctgtgcagg aaggcggcgg ggcagcgcct gccggtgccg atcatcgccg aggtggatct
ctacaagttc gacccgtggg atctgcccgA GCGCGCGCTG TTCGGCGCCA GGgagtggta cttcttcacc ccgcgggatc
gcaagtatcc taatgggtca cgccccaacc gcgccgccgg caacgggtac tggaaggcca ccggcgccga caagcccgtc
gcgccgcggg ggcgcacgct tgggatcaag aaggcgctcg tgttctacgc cggcaaggcg ccgcgagggg tcaagactga
ttggatcatg catgagtacc ggctCGCCGA TGCTGGCCGC GCCGCCGCGG GCGCCAAGAA GGGATCTCTC AGGGTAAGCT
TAGCTCAGAT TCATCCGAAT TACTAGCAAT GATCCTTGCT TCGATCGAAG ATTATTCGGT GGGAGTGATG ATCGATAATT
GGATCGTGGT CTGATCTGAT CTGGTGTGAA TTGTTTGTGC AGTTGGATGA TTGGGTGCTG TGTCGGCTGT ACAACAAGAA
GAACGAGTGG GAGAAGATGC AGCAGGGGAA GGAGGTGAAG GAGGAGGCGT CCGACATGGT TACGTCGCAG TCGCACTCGC
ACACCCACTC GTGGGGCGAG ACGCGCACGC CGGAGTCGGA GATCGTGGAC AACGACCCCT TCCCGGAGCT GGACTCGTTC
CCGGCGTTCC AGCCTGCGCC GCCGCCGGCG ACGGCGATGA TGGTGCCCAA GAAAGAATCG ATGGACGACG CCACCGCGGC
CGCCGCCGCC GCCGCCACCA TCCCCAGGAA CAACAGCAGC CTGTTCGTGG ACCTGAGCTA CGACGATATC CAGGGCATGT
ACAGCGGCCT CGACATGCTG CCGCCGGGCG ACGACTTCTA CTCGTCGCTC TTCGCGTCGC CGCGGGTGAA GGGGACGACG
CCACGCGCCG GCGCCGGCAT GGGCATGGTC CCGTTCTGAG GTGACGGCGA CGCGATCGAA CAGGTGGTGA TCGATGCTGC
AACGTGTGTA AATATACAGC GCCGGCTGGG TCAAGAGATG GCTCGGGTGA CGCGCGCGCG GCGTGTCCTG GCGTTGGCGC
CGGGGCATTC TTTAGTTTTT CATCTTTTCA TCATCTCAGA TGGTAGATAC AAAACAGTGT ATGTATGTAG CTCTGTTTCT
CTCTATAGAA CCCCAACAAA TTTTGTTGTT GATGTTGTTT ATCTTCATAT GCTTTGATCT TG