Os03t0819600-01

Locus

Os03g0819600

Description

Chalcone isomerase (EC 5.5.1.6), Flavonoid biosynthesis

RAP-DB Gene Symbol Synonym(s)

OsCHI, GH1, gh1

RAP-DB Gene Name Synonym(s)

chalcone isomerase, golden hull and internode 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

gh1, GH1, OsGH1, OsCHI, Cfi, CHI

Oryzabase Gene Name Synonym(s)

gold hull and internode 1, chalcone isomerase, chalcone flavonone isomerase, chalcone-flavonone isomerase

Transcript Evidence

AK061390

Protein Evidence

Q84T92

Literature

PMID: 22286805

Note

Manual Curation

August 6, 2020

Gene Ontology (GO)

Molecular Function: intramolecular lyase activity (GO:0016872)

Functional domain (InterPro)

Chalcone isomerase, 3-layer sandwich (IPR016088)

Chalcone isomerase superfamily (IPR036298)

Chalcone isomerase, orthogonal bundle domain superfamily (IPR016089)

Chalcone isomerase (IPR016087)

Experimentally confirmed subcellular location

endoplasmic reticulum (GO:0005783)

Full-length cDNA

006-305-C05 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0819600-01)

Others

Oryzabase (10365)

Transcript

877 bp

>Os03t0819600-01 Chalcone isomerase (EC 5.5.1.6), Flavonoid biosynthesis
ACAAAATTTGTCTCCACGTTTTCTTGGATAGTTAGTTGCTCACCCGATCCTGTATCCATG
GCGGCCGTGTCGGAGGTGGAGGTCGACGGCGTCGTGTTCCCGCCGGTGGCCCGCCCGCCG
GGCTCCGGCCACGCCCACTTCCTCGCCGGCGCAGGTGTGAGGGGAGTGGAGATCGCCGGC
AACTTCATCAAGTTCACGGCCATCGGCGTGTACCTGGAGGAGGGCGCGGCCGTGCCGGCG
CTGGCCAAGAAGTGGGCCGGCAAGTCCGCCGACGAGCTCGCCGCCGACGCCGCCTTCTTC
CGCGACGTCGTCACCGGCGATTTCGAGAAGTTCACGAGGGTGACGATGATCCTGCCGCTC
ACCGGCGAGCAGTACTCGGACAAGGTGACGGAGAACTGCGTCGCGGCGTGGAAGGCCGCC
GGCGTGTACACGGACGCCGAGGGCGCGGCCGCGGACAAGTTCAAGGAGGCCTTCAAGCCC
CACAGCTTCCCTCCGGGCGCGTCCATCCTCTTCACCCACTCCCCGCCCGGCGTCCTCACC
GTCGCGTTCTCCAAGGACTCGTCGGTGCCAGAGGGCGCCGTGGCGGCGGCGGCGATCGAG
AACAGGGCGCTCTGCGAGGCGGTGCTGGATTCCATCATCGGCGAGCACGGGGTCTCGCCG
GCGGCGAAGCGGAGCATAGCGGCCCGCGTCTCGCAGCTCCTGAAGGCGGAATCCACCGGC
GACGTGGCGGCGGCGGAGCCCGCGCCGGTGTCCGCGTGAAAATCGAGCTGCGAATTAACC
GCGCATCTAAGAGCTCCTCCTACACTTCTTGTACACTTCTACTGCCCTCGTGTTTGACAA
TGAAATAAAAGGAAAGGAGAAATCGCGGCTGTTCTTC

CDS

702 bp

>Os03t0819600-01 Chalcone isomerase (EC 5.5.1.6), Flavonoid biosynthesis
ATGGCGGCCGTGTCGGAGGTGGAGGTCGACGGCGTCGTGTTCCCGCCGGTGGCCCGCCCG
CCGGGCTCCGGCCACGCCCACTTCCTCGCCGGCGCAGGTGTGAGGGGAGTGGAGATCGCC
GGCAACTTCATCAAGTTCACGGCCATCGGCGTGTACCTGGAGGAGGGCGCGGCCGTGCCG
GCGCTGGCCAAGAAGTGGGCCGGCAAGTCCGCCGACGAGCTCGCCGCCGACGCCGCCTTC
TTCCGCGACGTCGTCACCGGCGATTTCGAGAAGTTCACGAGGGTGACGATGATCCTGCCG
CTCACCGGCGAGCAGTACTCGGACAAGGTGACGGAGAACTGCGTCGCGGCGTGGAAGGCC
GCCGGCGTGTACACGGACGCCGAGGGCGCGGCCGCGGACAAGTTCAAGGAGGCCTTCAAG
CCCCACAGCTTCCCTCCGGGCGCGTCCATCCTCTTCACCCACTCCCCGCCCGGCGTCCTC
ACCGTCGCGTTCTCCAAGGACTCGTCGGTGCCAGAGGGCGCCGTGGCGGCGGCGGCGATC
GAGAACAGGGCGCTCTGCGAGGCGGTGCTGGATTCCATCATCGGCGAGCACGGGGTCTCG
CCGGCGGCGAAGCGGAGCATAGCGGCCCGCGTCTCGCAGCTCCTGAAGGCGGAATCCACC
GGCGACGTGGCGGCGGCGGAGCCCGCGCCGGTGTCCGCGTGA

Protein

234 aa

>Os03t0819600-01 Chalcone isomerase (EC 5.5.1.6), Flavonoid biosynthesis
MAAVSEVEVDGVVFPPVARPPGSGHAHFLAGAGVRGVEIAGNFIKFTAIGVYLEEGAAVP
ALAKKWAGKSADELAADAAFFRDVVTGDFEKFTRVTMILPLTGEQYSDKVTENCVAAWKA
AGVYTDAEGAAADKFKEAFKPHSFPPGASILFTHSPPGVLTVAFSKDSSVPEGAVAAAAI
ENRALCEAVLDSIIGEHGVSPAAKRSIAARVSQLLKAESTGDVAAAEPAPVSA*

5'UTR

chr03:34395582..34395638 (- strand) : 57 bp

CDS

chr03:34395485..34395581 (- strand) : 97 bp

chr03:34395226..34395387 (- strand) : 162 bp

chr03:34394926..34395149 (- strand) : 224 bp

chr03:34394626..34394844 (- strand) : 219 bp

3'UTR

chr03:34394508..34394625 (- strand) : 118 bp

FASTA

>Os03t0819600-01 class=Sequence position=chr03:34394508..34395638 (- strand)
ACAAAATTTG TCTCCACGTT TTCTTGGATA GTTAGTTGCT CACCCGATCC TGTATCCATG GCGGCCGTGT CGGAGGTGGA
GGTCGACGGC GTCGTGTTCC CGCCGGTGGC CCGCCCGCCG GGCTCCGGCC ACGCCCACTT CCTCGCCGGC GCAGGTTTGT
TTGTGTTTGC GTTGTGTGTT CCGTGTCAGT GGAGAAGTGG AAATGCCGTG CAAGCGAACT TGCTTGCTGG TTTGATCGAT
CCGTCGTGCA GGTGTGAGGG GAGTGGAGAT CGCCGGCAAC TTCATCAAGT TCACGGCCAT CGGCGTGTAC CTGGAGGAGG
GCGCGGCCGT GCCGGCGCTG GCCAAGAAGT GGGCCGGCAA GTCCGCCGAC GAGCTCGCCG CCGACGCCGC CTTCTTCCGC
GACGTCGTCA CCGGTAACTC ATCTCGCTAA ATTTGTTGCT CGTGTCGACG GGCGGCGCGA CATGACATGG GCGTCGTCTC
GCGTTGCAGG CGATTTCGAG AAGTTCACGA GGGTGACGAT GATCCTGCCG CTCACCGGCG AGCAGTACTC GGACAAGGTG
ACGGAGAACT GCGTCGCGGC GTGGAAGGCC GCCGGCGTGT ACACGGACGC CGAGGGCGCG GCCGCGGACA AGTTCAAGGA
GGCCTTCAAG CCCCACAGCT TCCCTCCGGG CGCGTCCATC CTCTTCACCC ACTCCCCGCC CGGCGTCCTC ACCGTGAGCA
CCAATCCGTT GTTGCCGATT ACTCCGATGC GTGATTTGCT TCGTGATTTG GACTCCGTTT GATTCGATTT GCAGGTCGCG
TTCTCCAAGG ACTCGTCGGT GCCAGAGGGC GCCGTGGCGG CGGCGGCGAT CGAGAACAGG GCGCTCTGCG AGGCGGTGCT
GGATTCCATC ATCGGCGAGC ACGGGGTCTC GCCGGCGGCG AAGCGGAGCA TAGCGGCCCG CGTCTCGCAG CTCCTGAAGG
CGGAATCCAC CGGCGACGTG GCGGCGGCGG AGCCCGCGCC GGTGTCCGCG TGAAAATCGA GCTGCGAATT AACCGCGCAT
CTAAGAGCTC CTCCTACACT TCTTGTACAC TTCTACTGCC CTCGTGTTTG ACAATGAAAT AAAAGGAAAG GAGAAATCGC
GGCTGTTCTT C

Locus: Os03g0819600

Loading...

Locus: Os03g0819600

Loading...