Os03t0819600-02

Locus

Os03g0819600

Description

Chalcone isomerase (EC 5.5.1.6).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

gh1, GH1, OsGH1, OsCHI, Cfi, CHI

Oryzabase Gene Name Synonym(s)

gold hull and internode 1, chalcone isomerase, chalcone flavonone isomerase, chalcone-flavonone isomerase

Transcript Evidence

AK104791 (DDBJ, Best hit)

Protein Evidence

Q84T92 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: flavonoid biosynthetic process (GO:0009813)

Biological Process: cellular modified amino acid biosynthetic process (GO:0042398)

Molecular Function: intramolecular lyase activity (GO:0016872)

Molecular Function: chalcone isomerase activity (GO:0045430)

Functional domain (InterPro)

Chalcone isomerase, subgroup (IPR003466)

Chalcone isomerase (IPR016087)

Chalcone isomerase, 3-layer sandwich (IPR016088)

Full-length cDNA

001-039-F07 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0819600-02)

Others

Oryzabase (10365)

Transcript

834 bp

>Os03t0819600-02 Chalcone isomerase (EC 5.5.1.6).
GTTAGTTGCTCACCCGATCCTGTATCCATGGCGGCCGTGTCGGAGGTGGAGGTCGACGGC
GTCGTGTTCCCGCCGGTGGCCCGCCCGCCGGGCTCCGGCCACGCCCACTTCCTCGCCGGC
GCAGGTGTGAGGGGAGTGGAGATCGCCGGCAACTTCATCAAGTTCACGGCCATCGGCGTG
TACCTGGAGGAGGGCGCGGCCGTGCCGGCGCTGGCCAAGAAGTGGGCCGGCAAGTCCGCC
GACGAGCTCGCCGCCGACGCCGCCTTCTTCCGCGACGTCGTCACCGGCGATTTCGAGAAG
TTCACGAGGGTGACGATGATCCTGCCGCTCACCGGCGAGCAGTACTCGGACAAGGTGACG
GAGAACTGCGTCGCGGCGTGGAAGGCCGCCGGCGTGTACACGGACGCCGAGGGCGCGGCC
GCGGACAAGTTCAAGGAGGCCTTCAAGCCCCACAGCTTCCCTCCGGGCGCGTCCATCCTC
TTCACCCACTCCCCGCCCGGCGTCCTCACCGTCGCGTTCTCCAAGGACTCGTCGGTGCCA
GAGGGCGCCGTGGCGGCGGCGGCGATCGAGAACAGGGCGCTCTGCGAGGCGGTGCTGGAT
TCCATCATCGGCGAGCACGGGGTCTCGCCGGCGGCGAAGCGGAGCATAGCGGCCCGCGTC
TCGCAGCTCCTGAAGGCGGAATCCACCGGCGACGTGGCGGCGGCGGAGCCCGCGCCGGTG
TCCGCGTGAAAATCGAGCTGCGAATTAACCGCGCATCTAAGAGCTCCTCCTACACTTCTT
GTACACTTCTACTGCCCTCGTGTTTGACAATGAAATAAAAGGAAAGGAGAAATC

CDS

702 bp

>Os03t0819600-02 Chalcone isomerase (EC 5.5.1.6).
ATGGCGGCCGTGTCGGAGGTGGAGGTCGACGGCGTCGTGTTCCCGCCGGTGGCCCGCCCG
CCGGGCTCCGGCCACGCCCACTTCCTCGCCGGCGCAGGTGTGAGGGGAGTGGAGATCGCC
GGCAACTTCATCAAGTTCACGGCCATCGGCGTGTACCTGGAGGAGGGCGCGGCCGTGCCG
GCGCTGGCCAAGAAGTGGGCCGGCAAGTCCGCCGACGAGCTCGCCGCCGACGCCGCCTTC
TTCCGCGACGTCGTCACCGGCGATTTCGAGAAGTTCACGAGGGTGACGATGATCCTGCCG
CTCACCGGCGAGCAGTACTCGGACAAGGTGACGGAGAACTGCGTCGCGGCGTGGAAGGCC
GCCGGCGTGTACACGGACGCCGAGGGCGCGGCCGCGGACAAGTTCAAGGAGGCCTTCAAG
CCCCACAGCTTCCCTCCGGGCGCGTCCATCCTCTTCACCCACTCCCCGCCCGGCGTCCTC
ACCGTCGCGTTCTCCAAGGACTCGTCGGTGCCAGAGGGCGCCGTGGCGGCGGCGGCGATC
GAGAACAGGGCGCTCTGCGAGGCGGTGCTGGATTCCATCATCGGCGAGCACGGGGTCTCG
CCGGCGGCGAAGCGGAGCATAGCGGCCCGCGTCTCGCAGCTCCTGAAGGCGGAATCCACC
GGCGACGTGGCGGCGGCGGAGCCCGCGCCGGTGTCCGCGTGA

Protein

234 aa

>Os03t0819600-02 Chalcone isomerase (EC 5.5.1.6).
MAAVSEVEVDGVVFPPVARPPGSGHAHFLAGAGVRGVEIAGNFIKFTAIGVYLEEGAAVP
ALAKKWAGKSADELAADAAFFRDVVTGDFEKFTRVTMILPLTGEQYSDKVTENCVAAWKA
AGVYTDAEGAAADKFKEAFKPHSFPPGASILFTHSPPGVLTVAFSKDSSVPEGAVAAAAI
ENRALCEAVLDSIIGEHGVSPAAKRSIAARVSQLLKAESTGDVAAAEPAPVSA*

5'UTR

chr03:34395582..34395608 (- strand) : 27 bp

CDS

chr03:34395485..34395581 (- strand) : 97 bp

chr03:34395226..34395387 (- strand) : 162 bp

chr03:34394926..34395149 (- strand) : 224 bp

chr03:34394626..34394844 (- strand) : 219 bp

3'UTR

chr03:34394521..34394625 (- strand) : 105 bp

FASTA

>Os03t0819600-02 class=Sequence position=chr03:34394521..34395608 (- strand)
GTTAGTTGCT CACCCGATCC TGTATCCATG GCGGCCGTGT CGGAGGTGGA GGTCGACGGC GTCGTGTTCC CGCCGGTGGC
CCGCCCGCCG GGCTCCGGCC ACGCCCACTT CCTCGCCGGC GCAGGTTTGT TTGTGTTTGC GTTGTGTGTT CCGTGTCAGT
GGAGAAGTGG AAATGCCGTG CAAGCGAACT TGCTTGCTGG TTTGATCGAT CCGTCGTGCA GGTGTGAGGG GAGTGGAGAT
CGCCGGCAAC TTCATCAAGT TCACGGCCAT CGGCGTGTAC CTGGAGGAGG GCGCGGCCGT GCCGGCGCTG GCCAAGAAGT
GGGCCGGCAA GTCCGCCGAC GAGCTCGCCG CCGACGCCGC CTTCTTCCGC GACGTCGTCA CCGGTAACTC ATCTCGCTAA
ATTTGTTGCT CGTGTCGACG GGCGGCGCGA CATGACATGG GCGTCGTCTC GCGTTGCAGG CGATTTCGAG AAGTTCACGA
GGGTGACGAT GATCCTGCCG CTCACCGGCG AGCAGTACTC GGACAAGGTG ACGGAGAACT GCGTCGCGGC GTGGAAGGCC
GCCGGCGTGT ACACGGACGC CGAGGGCGCG GCCGCGGACA AGTTCAAGGA GGCCTTCAAG CCCCACAGCT TCCCTCCGGG
CGCGTCCATC CTCTTCACCC ACTCCCCGCC CGGCGTCCTC ACCGTGAGCA CCAATCCGTT GTTGCCGATT ACTCCGATGC
GTGATTTGCT TCGTGATTTG GACTCCGTTT GATTCGATTT GCAGGTCGCG TTCTCCAAGG ACTCGTCGGT GCCAGAGGGC
GCCGTGGCGG CGGCGGCGAT CGAGAACAGG GCGCTCTGCG AGGCGGTGCT GGATTCCATC ATCGGCGAGC ACGGGGTCTC
GCCGGCGGCG AAGCGGAGCA TAGCGGCCCG CGTCTCGCAG CTCCTGAAGG CGGAATCCAC CGGCGACGTG GCGGCGGCGG
AGCCCGCGCC GGTGTCCGCG TGAAAATCGA GCTGCGAATT AACCGCGCAT CTAAGAGCTC CTCCTACACT TCTTGTACAC
TTCTACTGCC CTCGTGTTTG ACAATGAAAT AAAAGGAAAG GAGAAATC

Locus: Os03g0819600

Loading...

Locus: Os03g0819600

Loading...