Os03t0820300-01

Locus

Os03g0820300

Description

TFIIIA-type zinc finger protein, Transcription activator, Abiotic stress tolerance

RAP-DB Gene Symbol Synonym(s)

ZFP182

RAP-DB Gene Name Synonym(s)

zinc finger protein ZFP182, zinc finger protein 182

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ZFP182

Oryzabase Gene Name Synonym(s)

zinc finger protein ZFP182, zinc finger protein 182

Transcript Evidence

AK068861

Protein Evidence

Q84T96

Literature

PMID: 22930448

PMID: 17434609

Note

Manual Curation

March 6, 2017

Gene Ontology (GO)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

Zinc finger, C2H2-like (IPR015880)

Zinc finger, C2H2 (IPR007087)

Full-length cDNA

J013170H07 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0820300-01)

RiceXPro (AK068861)

Others

Oryzabase (14683)

KEGG (Os03t0820300-01)

Transcript

851 bp

>Os03t0820300-01 TFIIIA-type zinc finger protein, Transcription activator, Abiotic stress tolerance
ATCCATCGATCTCCCCCCAACCAAAAATCTCTCTCTCAATCCATCGATCCATTAATTCAC
AAGCTTATCGAATCGGAGATGAAGCACCCGAGGCAGGAGGAGGAGGTGTCGCTGGCGCTG
GCGCTGAGCACGGACTGCTCGTCGACGGCGTCGGACTCGTCGGCGGCGGCGGCGGGCGGC
GCGGCGAGGAGGAAGAGGGCGCGGCGGAGGAGCGTGGTGGCGACGTCGGGGGAAGGGGAG
TTCGTGTGCAAGACTTGCAGCCGCGCGTTCCCGACCTTCCAGGCGCTCGGGGGCCACCGG
ACCAGCCACCTCCGCGGCCGGAGCAACGGGCTCGACCTCGGCGCCATCGGCGACAAGGCG
ATCAGGCTGCACAGGGCGGCCGACAAGGAGCACAGGGACAAGCACGAGTGCCACATCTGC
GGCCTCGGCTTCGAGATGGGCCAGGCGCTCGGCGGACACATGCGGCGCCACCGCGAGGAG
ATGGCCGCCGCCGGCGGTGGATCCTCCGCCGACGACTGGGTCTGGCGCTGCGACGCGCGG
CCGGAGGGGATCGCCGCCGAGCCACCGGTGTTGCTGGAGTTGTTCGCCTAGTTACCGCTG
GTCTCCATTAGTTTCGTCCAAGTTTTGAACTGACGCAGTGTGTGTCACCATTAATTAGTT
CATGTACATGTCTAGAAAAAAAAAGTCAGGTTCATCGATCTTGTAACTATGATAGGGGTT
TAATTTTTTTTTTCATTAGCGTTTGGGTTGTTCGGTTTTGAATCGGTCAGTTTTTGAACC
GTTTGGTGGAGATTTGTTGAGTTCAGATGTATATACACACACAGATGTAATATAATTCTT
TCATTCATAGC

CDS

513 bp

>Os03t0820300-01 TFIIIA-type zinc finger protein, Transcription activator, Abiotic stress tolerance
ATGAAGCACCCGAGGCAGGAGGAGGAGGTGTCGCTGGCGCTGGCGCTGAGCACGGACTGC
TCGTCGACGGCGTCGGACTCGTCGGCGGCGGCGGCGGGCGGCGCGGCGAGGAGGAAGAGG
GCGCGGCGGAGGAGCGTGGTGGCGACGTCGGGGGAAGGGGAGTTCGTGTGCAAGACTTGC
AGCCGCGCGTTCCCGACCTTCCAGGCGCTCGGGGGCCACCGGACCAGCCACCTCCGCGGC
CGGAGCAACGGGCTCGACCTCGGCGCCATCGGCGACAAGGCGATCAGGCTGCACAGGGCG
GCCGACAAGGAGCACAGGGACAAGCACGAGTGCCACATCTGCGGCCTCGGCTTCGAGATG
GGCCAGGCGCTCGGCGGACACATGCGGCGCCACCGCGAGGAGATGGCCGCCGCCGGCGGT
GGATCCTCCGCCGACGACTGGGTCTGGCGCTGCGACGCGCGGCCGGAGGGGATCGCCGCC
GAGCCACCGGTGTTGCTGGAGTTGTTCGCCTAG

Protein

171 aa

>Os03t0820300-01 TFIIIA-type zinc finger protein, Transcription activator, Abiotic stress tolerance
MKHPRQEEEVSLALALSTDCSSTASDSSAAAAGGAARRKRARRRSVVATSGEGEFVCKTC
SRAFPTFQALGGHRTSHLRGRSNGLDLGAIGDKAIRLHRAADKEHRDKHECHICGLGFEM
GQALGGHMRRHREEMAAAGGGSSADDWVWRCDARPEGIAAEPPVLLELFA*

5'UTR

chr03:34424180..34424257 (+ strand) : 78 bp

CDS

chr03:34424258..34424770 (+ strand) : 513 bp

3'UTR

chr03:34424771..34425030 (+ strand) : 260 bp

FASTA

>Os03t0820300-01 class=Sequence position=chr03:34424180..34425030 (+ strand)
ATCCATCGAT CTCCCCCCAA CCAAAAATCT CTCTCTCAAT CCATCGATCC ATTAATTCAC AAGCTTATCG AATCGGAGAT
GAAGCACCCG AGGCAGGAGG AGGAGGTGTC GCTGGCGCTG GCGCTGAGCA CGGACTGCTC GTCGACGGCG TCGGACTCGT
CGGCGGCGGC GGCGGGCGGC GCGGCGAGGA GGAAGAGGGC GCGGCGGAGG AGCGTGGTGG CGACGTCGGG GGAAGGGGAG
TTCGTGTGCA AGACTTGCAG CCGCGCGTTC CCGACCTTCC AGGCGCTCGG GGGCCACCGG ACCAGCCACC TCCGCGGCCG
GAGCAACGGG CTCGACCTCG GCGCCATCGG CGACAAGGCG ATCAGGCTGC ACAGGGCGGC CGACAAGGAG CACAGGGACA
AGCACGAGTG CCACATCTGC GGCCTCGGCT TCGAGATGGG CCAGGCGCTC GGCGGACACA TGCGGCGCCA CCGCGAGGAG
ATGGCCGCCG CCGGCGGTGG ATCCTCCGCC GACGACTGGG TCTGGCGCTG CGACGCGCGG CCGGAGGGGA TCGCCGCCGA
GCCACCGGTG TTGCTGGAGT TGTTCGCCTA GTTACCGCTG GTCTCCATTA GTTTCGTCCA AGTTTTGAAC TGACGCAGTG
TGTGTCACCA TTAATTAGTT CATGTACATG TCTAGAAAAA AAAAGTCAGG TTCATCGATC TTGTAACTAT GATAGGGGTT
TAATTTTTTT TTTCATTAGC GTTTGGGTTG TTCGGTTTTG AATCGGTCAG TTTTTGAACC GTTTGGTGGA GATTTGTTGA
GTTCAGATGT ATATACACAC ACAGATGTAA TATAATTCTT TCATTCATAG C