Os03t0821300-01

Locus

Os03g0821300

Description

Protein phosphatase 2C, Negative regulation of XA21-mediated innate immune response and cell death

RAP-DB Gene Symbol Synonym(s)

XB15

RAP-DB Gene Name Synonym(s)

XA21 binding protein 15

CGSNL Gene Symbol

XB15

CGSNL Gene Name

XA21 BINDING PROTEIN 15

Oryzabase Gene Symbol Synonym(s)

XB15, OsPP2C35, PP2C35, OsPP59, SIP35

Oryzabase Gene Name Synonym(s)

XA21 binding protein 15, protein phosphatase 2C35, protein phosphatase 2C 35, protein phosphatase 59, SKIP interacting protein 35, SKIPa-interacting protein 35, SKIPa-interacting protein 35

Transcript Evidence

AK071722

Protein Evidence

Q84T94

Literature

PMID: 18817453

Note

Manual Curation

January 14, 2021

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

PPM-type phosphatase domain superfamily (IPR036457)

PPM-type phosphatase domain (IPR001932)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

J023109I18 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0821300-01)

Others

Oryzabase (11144)

Transcript

2356 bp

>Os03t0821300-01 Protein phosphatase 2C, Negative regulation of XA21-mediated innate immune response and cell death
ATATTCCGGCATTTCAACCCCACCCACTCCGCACCCCCGCAAGTCAACTCTCTTCCTTCC
TCCTCCGTGCTTAATGCTCTCCGCATTATAACCACCCACCTCTCCTCCTCCCCCCACCTC
CTCTCTCTCTATCTCCATCTCCACCGCTACGCTTCCCAGCCATGGGCAACTCCCTCGCCT
GCTTCTGCTGCGGCGGCGGCGCCGGCGGCCGAGGCGGCCGCCACGTCGCCCCCGCCGCGC
TCCCCTCCGACCCGGCCTACGACGAGGGCCTGGGCCACTCGTTCTGCTACGTCCGCCCCG
ACAAGTTCGTGGTTCCCTTCTCCGCGGATGATTTGGTGGCTGACGCGAAGGCGGCCGCGG
CGGCGGAGGGGGAGGCGACCACGTTCCGGGCGATATCCGGGGCGGCGCTCAGTGCCAACG
TATCCACGCCGCTGTCCACGTCCGTGCTGCTGCTGATGCCGGAGGAGTCGTCGGCGTCCG
CCACCGCGTCGTCGGGGTTTGAGAGCTCGGAGTCGTTCGCTGCTGTGCCGCTGCAGCCGG
TGCCGAGGTTCTCGTCCGGGCCGATCTCCGCGCCCTTCTCCGGCGGGTTCATGTCGGGGC
CCTTGGAGAGGGGGTTCCAATCTGGGCCACTCGACGCCGCGCTCCTCTCGGGCCCTCTcc
ctggcaccgccacctccggtcgtatgggtggcgccgtccctgcgctccgccggagcctct
cccacggtggccgccgCCTCCGCAATTTCACCCGCGCGCTCCTCGCGCGCACCGAGAAGT
TTCAGGATTCTGCGGATCTAGGCTCGCCGGACGCCGCCGCCGCCGCCGTCGCCGCCTGTG
GGGGCGATCCCTGTGGTCTGCAGTGGGCGCAGGGGAAAGCCGGCGAGGACCGCGTCCACG
TCGTCGTGTCGGAGGAGCGAGGCTGGGTGTTCGTCGGCATCTACGATGGGTTCAACGGCC
CCGACGCCACCGACTTCCTGGTATCCAACCTCTACGCCGCCGTCCACCGCGAGCTCCGCG
GCCTCCTCTGGGATCAGCGGGAGCAGAACGTGCAGCACGACCAGCGCCCCGACCAACCCG
GCTCAGCCCCAAGCACCACGGCCTCAGATAACCAAGACCAGTGGGGTCGCCGCCGCCGCA
CCCGCCGCTCAAGACCGCCGCGTGGCGCCGACGACGACCAGCGGCGGTGGAAGTGCGAGT
GGGAGCAGGAGCGGGATTGCTCCAACCTGAAGCCACCAACGCAGCAGCGTCTTCGTTGCA
ACAGCGAGAACGACCACGTCGCCGTGCTCAAGGCGCTGACCCGTGCGCTGCACAGGACCG
AGGAGGCTTACCTGGACATCGCCGACAAGATGGTCGGCGAGTTCCCTGAGCTTGCGCTCA
TGGGCTCTTGTGTTCTTGCCATGCTCATGAAAGGAGAGGACATGTACATCATGAATGTTG
GCGATAGCCGGGCTGTGTTGGCAACAATGGACAGCGTCGATCTCGAGCAGATCAGCCAGG
GTTCATTCGATGGATCAGTCGGGGATTGCCCGCCATGCTTGTCGGCCGTGCAGCTCACGT
CGGATCACAGCACTTCAGTGGAAGAGGAAGTAATCAGAATACGAAACGAGCATCCTGATG
ATCCATCTGCCATCTCCAAGGATCGCGTGAAGGGCTCGCTGAAGGTGACCAGAGCATTTG
GTGCTGGGTTTTTGAAACAGCCCAAGTGGAATGATGCACTCCTGGAGATGTTCAGAATTG
ATTACGTTGGGTCCTCCCCATACATATCATGCAATCCATCCCTTTTTCATCATAAGCTCA
GCACAAGGGATAGATTCTTGATATTATCTTCAGATGGACTTTACCAGTATTTCACCAACG
AGGAGGCAGTTGCTCAGGTCGAAATGTTCATCGCAACAACCCCTGAAGGCGACCCTGCCC
AACATCTTGTGGAGGAAGTTCTTTTCCGTGCTGCCAACAAAGCAGGAATGGACTTTCATG
AACTGATCGAGATACCACATGGTGATCGTCGGCGATACCATGACGATGTATCTGTCATCG
TCATCTCTTTGGAGGGCAGGATTTGGAGATCCTGCGTGTAAATAGAAACAATAGTAGGCT
AGTGAAACAAAACGTATAGAGGGGGTTCTTCCCATGCCTTCCTTGAGCTGAGAGGTGTTC
TTGCGGCTACTCTACTCCTCTTCCCCCAGTTGCTACTGTACAATATCAACCAAGCACTGT
GGGGGGTTGGATTCGGCTTGGGCTCTCGGCACATCCAGCTGAATCGCCATGAATCGCCCG
CAGGGCTGGCCGCGTGGTATAATATGTTGATGTAAATGAGGATTTGTTCAATTATTAATA
ATTTATAAAATCGACC

CDS

1920 bp

>Os03t0821300-01 Protein phosphatase 2C, Negative regulation of XA21-mediated innate immune response and cell death
ATGGGCAACTCCCTCGCCTGCTTCTGCTGCGGCGGCGGCGCCGGCGGCCGAGGCGGCCGC
CACGTCGCCCCCGCCGCGCTCCCCTCCGACCCGGCCTACGACGAGGGCCTGGGCCACTCG
TTCTGCTACGTCCGCCCCGACAAGTTCGTGGTTCCCTTCTCCGCGGATGATTTGGTGGCT
GACGCGAAGGCGGCCGCGGCGGCGGAGGGGGAGGCGACCACGTTCCGGGCGATATCCGGG
GCGGCGCTCAGTGCCAACGTATCCACGCCGCTGTCCACGTCCGTGCTGCTGCTGATGCCG
GAGGAGTCGTCGGCGTCCGCCACCGCGTCGTCGGGGTTTGAGAGCTCGGAGTCGTTCGCT
GCTGTGCCGCTGCAGCCGGTGCCGAGGTTCTCGTCCGGGCCGATCTCCGCGCCCTTCTCC
GGCGGGTTCATGTCGGGGCCCTTGGAGAGGGGGTTCCAATCTGGGCCACTCGACGCCGCG
CTCCTCTCGGGCCCTCTccctggcaccgccacctccggtcgtatgggtggcgccgtccct
gcgctccgccggagcctctcccacggtggccgccgCCTCCGCAATTTCACCCGCGCGCTC
CTCGCGCGCACCGAGAAGTTTCAGGATTCTGCGGATCTAGGCTCGCCGGACGCCGCCGCC
GCCGCCGTCGCCGCCTGTGGGGGCGATCCCTGTGGTCTGCAGTGGGCGCAGGGGAAAGCC
GGCGAGGACCGCGTCCACGTCGTCGTGTCGGAGGAGCGAGGCTGGGTGTTCGTCGGCATC
TACGATGGGTTCAACGGCCCCGACGCCACCGACTTCCTGGTATCCAACCTCTACGCCGCC
GTCCACCGCGAGCTCCGCGGCCTCCTCTGGGATCAGCGGGAGCAGAACGTGCAGCACGAC
CAGCGCCCCGACCAACCCGGCTCAGCCCCAAGCACCACGGCCTCAGATAACCAAGACCAG
TGGGGTCGCCGCCGCCGCACCCGCCGCTCAAGACCGCCGCGTGGCGCCGACGACGACCAG
CGGCGGTGGAAGTGCGAGTGGGAGCAGGAGCGGGATTGCTCCAACCTGAAGCCACCAACG
CAGCAGCGTCTTCGTTGCAACAGCGAGAACGACCACGTCGCCGTGCTCAAGGCGCTGACC
CGTGCGCTGCACAGGACCGAGGAGGCTTACCTGGACATCGCCGACAAGATGGTCGGCGAG
TTCCCTGAGCTTGCGCTCATGGGCTCTTGTGTTCTTGCCATGCTCATGAAAGGAGAGGAC
ATGTACATCATGAATGTTGGCGATAGCCGGGCTGTGTTGGCAACAATGGACAGCGTCGAT
CTCGAGCAGATCAGCCAGGGTTCATTCGATGGATCAGTCGGGGATTGCCCGCCATGCTTG
TCGGCCGTGCAGCTCACGTCGGATCACAGCACTTCAGTGGAAGAGGAAGTAATCAGAATA
CGAAACGAGCATCCTGATGATCCATCTGCCATCTCCAAGGATCGCGTGAAGGGCTCGCTG
AAGGTGACCAGAGCATTTGGTGCTGGGTTTTTGAAACAGCCCAAGTGGAATGATGCACTC
CTGGAGATGTTCAGAATTGATTACGTTGGGTCCTCCCCATACATATCATGCAATCCATCC
CTTTTTCATCATAAGCTCAGCACAAGGGATAGATTCTTGATATTATCTTCAGATGGACTT
TACCAGTATTTCACCAACGAGGAGGCAGTTGCTCAGGTCGAAATGTTCATCGCAACAACC
CCTGAAGGCGACCCTGCCCAACATCTTGTGGAGGAAGTTCTTTTCCGTGCTGCCAACAAA
GCAGGAATGGACTTTCATGAACTGATCGAGATACCACATGGTGATCGTCGGCGATACCAT
GACGATGTATCTGTCATCGTCATCTCTTTGGAGGGCAGGATTTGGAGATCCTGCGTGTAA

Protein

640 aa

>Os03t0821300-01 Protein phosphatase 2C, Negative regulation of XA21-mediated innate immune response and cell death
MGNSLACFCCGGGAGGRGGRHVAPAALPSDPAYDEGLGHSFCYVRPDKFVVPFSADDLVA
DAKAAAAAEGEATTFRAISGAALSANVSTPLSTSVLLLMPEESSASATASSGFESSESFA
AVPLQPVPRFSSGPISAPFSGGFMSGPLERGFQSGPLDAALLSGPLPGTATSGRMGGAVP
ALRRSLSHGGRRLRNFTRALLARTEKFQDSADLGSPDAAAAAVAACGGDPCGLQWAQGKA
GEDRVHVVVSEERGWVFVGIYDGFNGPDATDFLVSNLYAAVHRELRGLLWDQREQNVQHD
QRPDQPGSAPSTTASDNQDQWGRRRRTRRSRPPRGADDDQRRWKCEWEQERDCSNLKPPT
QQRLRCNSENDHVAVLKALTRALHRTEEAYLDIADKMVGEFPELALMGSCVLAMLMKGED
MYIMNVGDSRAVLATMDSVDLEQISQGSFDGSVGDCPPCLSAVQLTSDHSTSVEEEVIRI
RNEHPDDPSAISKDRVKGSLKVTRAFGAGFLKQPKWNDALLEMFRIDYVGSSPYISCNPS
LFHHKLSTRDRFLILSSDGLYQYFTNEEAVAQVEMFIATTPEGDPAQHLVEEVLFRAANK
AGMDFHELIEIPHGDRRRYHDDVSVIVISLEGRIWRSCV*

5'UTR

chr03:34478210..34478370 (- strand) : 161 bp

CDS

chr03:34476785..34478209 (- strand) : 1425 bp

chr03:34476578..34476691 (- strand) : 114 bp

chr03:34475244..34475508 (- strand) : 265 bp

chr03:34474991..34475106 (- strand) : 116 bp

3'UTR

chr03:34474716..34474990 (- strand) : 275 bp

FASTA

>Os03t0821300-01 class=Sequence position=chr03:34474716..34478370 (- strand)
ATATTCCGGC ATTTCAACCC CACCCACTCC GCACCCCCGC AAGTCAACTC TCTTCCTTCC TCCTCCGTGC TTAATGCTCT
CCGCATTATA ACCACCCACC TCTCCTCCTC CCCCCACCTC CTCTCTCTCT ATCTCCATCT CCACCGCTAC GCTTCCCAGC
CATGGGCAAC TCCCTCGCCT GCTTCTGCTG CGGCGGCGGC GCCGGCGGCC GAGGCGGCCG CCACGTCGCC CCCGCCGCGC
TCCCCTCCGA CCCGGCCTAC GACGAGGGCC TGGGCCACTC GTTCTGCTAC GTCCGCCCCG ACAAGTTCGT GGTTCCCTTC
TCCGCGGATG ATTTGGTGGC TGACGCGAAG GCGGCCGCGG CGGCGGAGGG GGAGGCGACC ACGTTCCGGG CGATATCCGG
GGCGGCGCTC AGTGCCAACG TATCCACGCC GCTGTCCACG TCCGTGCTGC TGCTGATGCC GGAGGAGTCG TCGGCGTCCG
CCACCGCGTC GTCGGGGTTT GAGAGCTCGG AGTCGTTCGC TGCTGTGCCG CTGCAGCCGG TGCCGAGGTT CTCGTCCGGG
CCGATCTCCG CGCCCTTCTC CGGCGGGTTC ATGTCGGGGC CCTTGGAGAG GGGGTTCCAA TCTGGGCCAC TCGACGCCGC
GCTCCTCTCG GGCCCTCTcc ctggcaccgc cacctccggt cgtatgggtg gcgccgtccc tgcgctccgc cggagcctct
cccacggtgg ccgccgCCTC CGCAATTTCA CCCGCGCGCT CCTCGCGCGC ACCGAGAAGT TTCAGGATTC TGCGGATCTA
GGCTCGCCGG ACGCCGCCGC CGCCGCCGTC GCCGCCTGTG GGGGCGATCC CTGTGGTCTG CAGTGGGCGC AGGGGAAAGC
CGGCGAGGAC CGCGTCCACG TCGTCGTGTC GGAGGAGCGA GGCTGGGTGT TCGTCGGCAT CTACGATGGG TTCAACGGCC
CCGACGCCAC CGACTTCCTG GTATCCAACC TCTACGCCGC CGTCCACCGC GAGCTCCGCG GCCTCCTCTG GGATCAGCGG
GAGCAGAACG TGCAGCACGA CCAGCGCCCC GACCAACCCG GCTCAGCCCC AAGCACCACG GCCTCAGATA ACCAAGACCA
GTGGGGTCGC CGCCGCCGCA CCCGCCGCTC AAGACCGCCG CGTGGCGCCG ACGACGACCA GCGGCGGTGG AAGTGCGAGT
GGGAGCAGGA GCGGGATTGC TCCAACCTGA AGCCACCAAC GCAGCAGCGT CTTCGTTGCA ACAGCGAGAA CGACCACGTC
GCCGTGCTCA AGGCGCTGAC CCGTGCGCTG CACAGGACCG AGGAGGCTTA CCTGGACATC GCCGACAAGA TGGTCGGCGA
GTTCCCTGAG CTTGCGCTCA TGGGCTCTTG TGTTCTTGCC ATGCTCATGA AAGGAGAGGA CATGTACATC ATGAATGTTG
GCGATAGCCG GGCTGTGTTG GCAACAATGG ACAGCGTCGA TCTCGAGCAG ATCAGCCAGG GTTCATTCGA TGGATCAGTC
GGGGATTGCC CGCCATGCTT GTCGGCCGTG CAGCTCACGT CGGATCACAG CACTTCAGTG GAAGAGGTGA TTGAATCGAC
TCATATCATG GTTCAATCCT ATTGGAATTG CTGTTCTTAA TGTTGCTTAA GTCTCATATT TGTTTCTGCC TGAATACAGG
AAGTAATCAG AATACGAAAC GAGCATCCTG ATGATCCATC TGCCATCTCC AAGGATCGCG TGAAGGGCTC GCTGAAGGTG
ACCAGAGCAT TTGGTGCTGG GTTTTTGAAA CAGGTTAGTT CATTTGAATA TGCCCTTTTT TTTTGCAGAA AGACATTTTT
TTGTGCTCCG TTATGATTAA GCGTTTTGCC ATTGGCCAAG TTTCAAAGTT GCGTATGTGG ATTTATTTTT TGGCAAGTAA
TATGCAATTT CAGAATGACA CAATTAGTCA ATGTATGAAA TAAGTATGTG ACCTGACTTC CTTCCTTGAA TTTGGGATCT
GTATTGATGA TAAAGCATAC GGTCCAAACT TGATTATACC AGGAGCGGAA TAATTAAGGT CAGTTTTGCT GCTATCCTGA
GTCAAACACA TAATTAAGGT CATAATTAAA CTAGGTCAGA AAAAGGAAAA CTGGATCTGG TCTAATTGGT CCAAAGTTTG
AAAAGTAAAG TGAGCCACTC TAAATTCTCA CTTCTTTGGG GTGAGAAATA TGACCATCCT ACACTGAAAC TGACCATGTC
TGACGGGGAC ATCATAAACC ATATGCTAAT TTCAATGGGC AAAAACTTCA ACGCATGAAA ACTAATTAGT TAAATTCTTG
AGTCACCGCG TGTATAGCCA GTTCAAAATT TTGAATGAGA AGCTGCTCCA AGAGAAAATG AAGTTTCTTT TGCTTCTGTC
CAAGTACAAA GAATCTGCTT GTGCAGTACT AAAATGTGGC CAGAAAAGAG TGAGTTGAGT GGCTTTGAAG GAAGGTACGT
TTCTCCTCCC ATGCGAAGAA CTATTCTCTA TTGTCAACTG CACAAATCTA TCTTGCTGCT ATGCAAGAGG GAAGTCTCTT
TCTTGGACAT AAAGTGAGCT ATCTGATGAG ACAGACATGG CGATCTGCGA TATTTTGTCA ATGAAGAAAT CCCCCAAAGT
TAAGCAGCAC AGAGAATTGA ACAAGTGCAT GAGGCAGCCC TTTCTACTGA TTTAGTTGTC GGTACAATTT TCAGATAGCC
TGGTTGGAAG TTGCAAATAG TTAATTTTAC AAGCAAATCC ATAGCGAACA ATACATGCAT CATTTGTTTT TGCTCTCTGT
CTGCACCTTA TATCATAATT CCTTAGCATT TTGATCTCAC AATTCTCTCT CTTTTTTAAC AGCCCAAGTG GAATGATGCA
CTCCTGGAGA TGTTCAGAAT TGATTACGTT GGGTCCTCCC CATACATATC ATGCAATCCA TCCCTTTTTC ATCATAAGCT
CAGCACAAGG GATAGATTCT TGATATTATC TTCAGATGGA CTTTACCAGT ATTTCACCAA CGAGGAGGCA GTTGCTCAGG
TCGAAATGTT CATCGCAACA ACCCCTGAAG GCGACCCTGC CCAACATCTT GTGGAGGAAG TTCTTTTCCG TGCTGCCAAC
AAAGCAGGTG TGTTTGCAAA GAAGTCACCA TACATGTCAA ATGTGTCGAC CTCATTTTGC AGTAACTTTT GAACTTCTAG
AACATGATGC TGAATTTTGT CAGTCAATGA CCTGACCTCA TTTTTACATC TATTGCTGTT GCAGGAATGG ACTTTCATGA
ACTGATCGAG ATACCACATG GTGATCGTCG GCGATACCAT GACGATGTAT CTGTCATCGT CATCTCTTTG GAGGGCAGGA
TTTGGAGATC CTGCGTGTAA ATAGAAACAA TAGTAGGCTA GTGAAACAAA ACGTATAGAG GGGGTTCTTC CCATGCCTTC
CTTGAGCTGA GAGGTGTTCT TGCGGCTACT CTACTCCTCT TCCCCCAGTT GCTACTGTAC AATATCAACC AAGCACTGTG
GGGGGTTGGA TTCGGCTTGG GCTCTCGGCA CATCCAGCTG AATCGCCATG AATCGCCCGC AGGGCTGGCC GCGTGGTATA
ATATGTTGAT GTAAATGAGG ATTTGTTCAA TTATTAATAA TTTATAAAAT CGACC

Locus: Os03g0821300

Loading...

Locus: Os03g0821300

Loading...