Os03t0821300-02

Locus

Os03g0821300

Description

Similar to Protein phosphatase 2C 35.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

XB15

CGSNL Gene Name

XA21 BINDING PROTEIN 15

Oryzabase Gene Symbol Synonym(s)

XB15, OsPP2C35, PP2C35, OsPP59, SIP35

Oryzabase Gene Name Synonym(s)

XA21 binding protein 15, protein phosphatase 2C35, protein phosphatase 2C 35, protein phosphatase 59, SKIP interacting protein 35, SKIPa-interacting protein 35, SKIPa-interacting protein 35

Transcript Evidence

AK073306 (DDBJ, Best hit)

Protein Evidence

Q84T94 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Protein phosphatase 2C-like (IPR001932)

Protein phosphatase 2C (IPR015655)

Full-length cDNA

J033025G07 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0821300-02)

Others

Oryzabase (11144)

Transcript

1061 bp

>Os03t0821300-02 Similar to Protein phosphatase 2C 35.
GGACCGAGGAGGCTTACCTGGACATCGCCGACAAGATGGTCGGCGAGTTCCCTGAGCTTG
CGCTCATGGGCTCTTGTGTTCTTGCCATGCTCATGAAAGGAGAGGACATGTACATCATGA
ATGTTGGCGATAGCCGGGCTGTGTTGGCAACAATGGACAGCGTCGATCTCGAGCAGATCA
GCCAGGGTTCATTCGATGGATCAGTCGGGGATTGCCCGCCATGCTTGTCGGCCGTGCAGC
TCACGTCGGATCACAGCACTTCAGTGGAAGAGGAAGTAATCAGAATACGAAACGAGCATC
CTGATGATCCATCTGCCATCTCCAAGGATCGCGTGAAGGGCTCGCTGAAGGTGACCAGAG
CATTTGGTGCTGGGTTTTTGAAACAGCCCAAGTGGAATGATGCACTCCTGGAGATGTTCA
GAATTGATTACGTTGGGTCCTCCCCATACATATCATGCAATCCATCCCTTTTTCATCATA
AGCTCAGCACAAGGGATAGATTCTTGATATTATCTTCAGATGGACTTTACCAGTATTTCA
CCAACGAGGAGGCAGTTGCTCAGGTCGAAATGTTCATCGCAACAACCCCTGAAGGCGACC
CTGCCCAACATCTTGTGGAGGAAGTTCTTTTCCGTGCTGCCAACAAAGCAGGAATGGACT
TTCATGAACTGATCGAGATACCACATGGTGATCGTCGGCGATACCATGACGATGTATCTG
TCATCGTCATCTCTTTGGAGGGCAGGATTTGGAGATCCTGCGTGTAAATAGAAACAATAG
TAGGCTAGTGAAACAAAACGTATAGAGGGGGTTCTTCCCATGCCTTCCTTGAGCTGAGAG
GTGTTCTTGCGGCTACTCTACTCCTCTTCCCCCAGTTGCTACTGTACAATATCAACCAAG
CACTGTGGGGGGTTGGATTCGGCTTGGGCTCTCGGCACATCCAGCTGAATCGCCATGAAT
CGCCCGCAGGGCTGGCCGCGTGGTATAATATGTTGATGTAAATGAGGATTTGTTCAATTA
TTAATAATTTATAAAATCGACCAATTGGTCAACTTTCTTTG

CDS

765 bp

>Os03t0821300-02 Similar to Protein phosphatase 2C 35.
ACCGAGGAGGCTTACCTGGACATCGCCGACAAGATGGTCGGCGAGTTCCCTGAGCTTGCG
CTCATGGGCTCTTGTGTTCTTGCCATGCTCATGAAAGGAGAGGACATGTACATCATGAAT
GTTGGCGATAGCCGGGCTGTGTTGGCAACAATGGACAGCGTCGATCTCGAGCAGATCAGC
CAGGGTTCATTCGATGGATCAGTCGGGGATTGCCCGCCATGCTTGTCGGCCGTGCAGCTC
ACGTCGGATCACAGCACTTCAGTGGAAGAGGAAGTAATCAGAATACGAAACGAGCATCCT
GATGATCCATCTGCCATCTCCAAGGATCGCGTGAAGGGCTCGCTGAAGGTGACCAGAGCA
TTTGGTGCTGGGTTTTTGAAACAGCCCAAGTGGAATGATGCACTCCTGGAGATGTTCAGA
ATTGATTACGTTGGGTCCTCCCCATACATATCATGCAATCCATCCCTTTTTCATCATAAG
CTCAGCACAAGGGATAGATTCTTGATATTATCTTCAGATGGACTTTACCAGTATTTCACC
AACGAGGAGGCAGTTGCTCAGGTCGAAATGTTCATCGCAACAACCCCTGAAGGCGACCCT
GCCCAACATCTTGTGGAGGAAGTTCTTTTCCGTGCTGCCAACAAAGCAGGAATGGACTTT
CATGAACTGATCGAGATACCACATGGTGATCGTCGGCGATACCATGACGATGTATCTGTC
ATCGTCATCTCTTTGGAGGGCAGGATTTGGAGATCCTGCGTGTAA

Protein

255 aa

>Os03t0821300-02 Similar to Protein phosphatase 2C 35.
TEEAYLDIADKMVGEFPELALMGSCVLAMLMKGEDMYIMNVGDSRAVLATMDSVDLEQIS
QGSFDGSVGDCPPCLSAVQLTSDHSTSVEEEVIRIRNEHPDDPSAISKDRVKGSLKVTRA
FGAGFLKQPKWNDALLEMFRIDYVGSSPYISCNPSLFHHKLSTRDRFLILSSDGLYQYFT
NEEAVAQVEMFIATTPEGDPAQHLVEEVLFRAANKAGMDFHELIEIPHGDRRRYHDDVSV
IVISLEGRIWRSCV*

5'UTR

chr03:34477055..34477056 (- strand) : 2 bp

CDS

chr03:34476785..34477054 (- strand) : 270 bp

chr03:34476578..34476691 (- strand) : 114 bp

chr03:34475244..34475508 (- strand) : 265 bp

chr03:34474991..34475106 (- strand) : 116 bp

3'UTR

chr03:34474697..34474990 (- strand) : 294 bp

FASTA

>Os03t0821300-02 class=Sequence position=chr03:34474697..34477056 (- strand)
GGACCGAGGA GGCTTACCTG GACATCGCCG ACAAGATGGT CGGCGAGTTC CCTGAGCTTG CGCTCATGGG CTCTTGTGTT
CTTGCCATGC TCATGAAAGG AGAGGACATG TACATCATGA ATGTTGGCGA TAGCCGGGCT GTGTTGGCAA CAATGGACAG
CGTCGATCTC GAGCAGATCA GCCAGGGTTC ATTCGATGGA TCAGTCGGGG ATTGCCCGCC ATGCTTGTCG GCCGTGCAGC
TCACGTCGGA TCACAGCACT TCAGTGGAAG AGGTGATTGA ATCGACTCAT ATCATGGTTC AATCCTATTG GAATTGCTGT
TCTTAATGTT GCTTAAGTCT CATATTTGTT TCTGCCTGAA TACAGGAAGT AATCAGAATA CGAAACGAGC ATCCTGATGA
TCCATCTGCC ATCTCCAAGG ATCGCGTGAA GGGCTCGCTG AAGGTGACCA GAGCATTTGG TGCTGGGTTT TTGAAACAGG
TTAGTTCATT TGAATATGCC CTTTTTTTTT GCAGAAAGAC ATTTTTTTGT GCTCCGTTAT GATTAAGCGT TTTGCCATTG
GCCAAGTTTC AAAGTTGCGT ATGTGGATTT ATTTTTTGGC AAGTAATATG CAATTTCAGA ATGACACAAT TAGTCAATGT
ATGAAATAAG TATGTGACCT GACTTCCTTC CTTGAATTTG GGATCTGTAT TGATGATAAA GCATACGGTC CAAACTTGAT
TATACCAGGA GCGGAATAAT TAAGGTCAGT TTTGCTGCTA TCCTGAGTCA AACACATAAT TAAGGTCATA ATTAAACTAG
GTCAGAAAAA GGAAAACTGG ATCTGGTCTA ATTGGTCCAA AGTTTGAAAA GTAAAGTGAG CCACTCTAAA TTCTCACTTC
TTTGGGGTGA GAAATATGAC CATCCTACAC TGAAACTGAC CATGTCTGAC GGGGACATCA TAAACCATAT GCTAATTTCA
ATGGGCAAAA ACTTCAACGC ATGAAAACTA ATTAGTTAAA TTCTTGAGTC ACCGCGTGTA TAGCCAGTTC AAAATTTTGA
ATGAGAAGCT GCTCCAAGAG AAAATGAAGT TTCTTTTGCT TCTGTCCAAG TACAAAGAAT CTGCTTGTGC AGTACTAAAA
TGTGGCCAGA AAAGAGTGAG TTGAGTGGCT TTGAAGGAAG GTACGTTTCT CCTCCCATGC GAAGAACTAT TCTCTATTGT
CAACTGCACA AATCTATCTT GCTGCTATGC AAGAGGGAAG TCTCTTTCTT GGACATAAAG TGAGCTATCT GATGAGACAG
ACATGGCGAT CTGCGATATT TTGTCAATGA AGAAATCCCC CAAAGTTAAG CAGCACAGAG AATTGAACAA GTGCATGAGG
CAGCCCTTTC TACTGATTTA GTTGTCGGTA CAATTTTCAG ATAGCCTGGT TGGAAGTTGC AAATAGTTAA TTTTACAAGC
AAATCCATAG CGAACAATAC ATGCATCATT TGTTTTTGCT CTCTGTCTGC ACCTTATATC ATAATTCCTT AGCATTTTGA
TCTCACAATT CTCTCTCTTT TTTAACAGCC CAAGTGGAAT GATGCACTCC TGGAGATGTT CAGAATTGAT TACGTTGGGT
CCTCCCCATA CATATCATGC AATCCATCCC TTTTTCATCA TAAGCTCAGC ACAAGGGATA GATTCTTGAT ATTATCTTCA
GATGGACTTT ACCAGTATTT CACCAACGAG GAGGCAGTTG CTCAGGTCGA AATGTTCATC GCAACAACCC CTGAAGGCGA
CCCTGCCCAA CATCTTGTGG AGGAAGTTCT TTTCCGTGCT GCCAACAAAG CAGGTGTGTT TGCAAAGAAG TCACCATACA
TGTCAAATGT GTCGACCTCA TTTTGCAGTA ACTTTTGAAC TTCTAGAACA TGATGCTGAA TTTTGTCAGT CAATGACCTG
ACCTCATTTT TACATCTATT GCTGTTGCAG GAATGGACTT TCATGAACTG ATCGAGATAC CACATGGTGA TCGTCGGCGA
TACCATGACG ATGTATCTGT CATCGTCATC TCTTTGGAGG GCAGGATTTG GAGATCCTGC GTGTAAATAG AAACAATAGT
AGGCTAGTGA AACAAAACGT ATAGAGGGGG TTCTTCCCAT GCCTTCCTTG AGCTGAGAGG TGTTCTTGCG GCTACTCTAC
TCCTCTTCCC CCAGTTGCTA CTGTACAATA TCAACCAAGC ACTGTGGGGG GTTGGATTCG GCTTGGGCTC TCGGCACATC
CAGCTGAATC GCCATGAATC GCCCGCAGGG CTGGCCGCGT GGTATAATAT GTTGATGTAA ATGAGGATTT GTTCAATTAT
TAATAATTTA TAAAATCGAC CAATTGGTCA ACTTTCTTTG 

Locus: Os03g0821300

Loading...

Locus: Os03g0821300

Loading...