Os03t0825700-01

Locus

Os03g0825700

Description

Ca2+ binding protein, Regulation of tapetal cell degradation and pollen formation

RAP-DB Gene Symbol Synonym(s)

Os DEX1, OsDEX1

RAP-DB Gene Name Synonym(s)

DEFECTIVE IN EXINE PATTERN FORMATION 1, Defective in Exine Formation 1

CGSNL Gene Symbol

DEX1

CGSNL Gene Name

DEFECTIVE IN EXINE PATTERN FORMATION 1

Oryzabase Gene Symbol Synonym(s)

Os DEX1, OsDEX1

Oryzabase Gene Name Synonym(s)

Defective in Exine Formation 1

Transcript Evidence

XM_015775749

AK067902

Protein Evidence

Q10BA5

Literature

PMID: 27663411

Note

Manual Curation

November 8, 2016

Functional domain (InterPro)

Quinoprotein alcohol dehydrogenase-like domain (IPR027295)

Full-length cDNA

J013121O19 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0825700-01)

RiceXPro (AK067902)

Others

Oryzabase (18163)

KEGG (Os03t0825700-01)

Transcript

3032 bp

>Os03t0825700-01 Ca2+ binding protein, Regulation of tapetal cell degradation and pollen formation
GTCTCTTTCGCCATTTCGGATTCCCCACCCGACGAGTCTCCGACCACTTCCCACACCGGC
GCCTCCACGCCGAGATCTCCTTCCCTCTCCACCGCCGGCGACCGCCGCGGCGCGGCGAGG
CCCTCGGGGTCTAGGGTTTTGTACTCAGATGCGTCCCCTCCTCGCCTTCGCGGCGGTATG
CGCCCTTCTCGTGGCTGCCGCAGCGCCGGCGGCCGCGGAGGAGGAGAAGGCGAACAAGTT
CCGGCAGCGCGAGGCCACCGACGACATGCTTGGATACCCCCACCTTGATGAAGATGCTTT
ATTGAAGACCAAGTGTCCAAAACATGTAGAGCTGAGATGGCAGACTGAAGTTAGTTCCAG
CATTTATGCAACTCCGTTGATCGCTGATATCAACAGCGATGGAAAGTTGGAAGTAGTGGT
GCCATCATTTGTTCATTACCTGGAAGTTCTTGAAGGCTCTGATGGGGACAAATTGCCAGG
ATGGCCTGCATTTCACCAGTCAAATGTTCATTCAAGTCCACTTCTATATGATATTGACAA
GGACGGGACACGGGAAATAGTTTTGGCAACTTACAATGGTGTAGTGAATTTCTTCAGGGT
ATCAGGTTATATGATGATGGACAAGCTAGAAGTACCTCGTAGGAAGGTACACAAAGACTG
GTATGTTGGGCTGAATACAGATCCCGTTGACCGCTCCCATCCAGATGTTCATGACAGCTC
AATTGCAAAGAAAGCTGCTTCTGAAGAATCTCACCCAAATATTCAGGACAAGCCAGTTGT
GAATGAATCTTCTAAGGAATCCCAGTCACGGAGCACAAATGACTCAACAACACGAGGAGT
TGATTCCATGAAACATGCGTCTAAGGAAGAGCCAGTTGAAAGTAAACCTAATTCTACCCG
AGGACAGGAGAATATGGATGTGTTAAACAATCTAAACAGCACAGATGCTGGGAACAACTC
TAGTTTAAGTACTACAACAGAGAATGCATCACATGTTCAGAGAAGGTTGCTTCAAACAGA
TGAGAAAAGTAATCAAGCAGGAAGCTCAGAAACTGATGCAAGTGATACCGGAACAGCAAA
AGCAGCTACTGTTGAAAATAGCGAGCCTCTAGAGGCTGATGCTGATGCATCATTTAATTT
GTTTCGGGATGTAGAAGATCTGCCTGATGAGTACAATTACGATTATGATGACTACGTTGA
TGAAACCATGTGGGGAGACGAGGACTGGAAAGAACAACAACATGAAAAGGCAGAAGATTA
TGTGAGCATAGATGCTCACATCTTGTCCACCCCAGTGATTGCAGATATTGACAGAGATGG
CATACAAGAAATGGTGATTTCTGTATCTTACTTCTTTGACCACGAGTATTATGATAAACC
AGAACATCTAAAGGAGTTAGGAGGGATTGACATTGGCAAATATATTGCAAGCAGTATAGT
TGTTTTTAACCTTGACACAAGACAAGTCAAATGGACTGCAGAACTTGATTTGAGTACAGA
TAGTGGAAATTTTACTGCCCATGCATATTCTTCGCCGACCGTGGTTGATTTGGATGGTGA
TGGAAATTTGGATATTCTTGTTGGAACTTCCTTTGGCTTGTTTTATGTTATCGATCATCG
TGGTAAGGTTAGGAACAAGTTCCCACTTGAGATGGCGGAGATTCATGCACCAGTCATTGC
AGCAGATATCAATGATGATGGGAAAATCGAGATGGTCACTGCTGATGTCCATGGCAATGT
AGCAGCATGGACTGCAGAGGGAGAAGAAATCTGGGAGGTTCATCTTAAGAGTCTTATCCC
ACAGCGCCCTACTGTTGGTGATGTTAATGGAGATGGTCGCACTGAAGTTGTGGTCCCAAC
CGTGTCAGGAAACATATATGTTCTTAGTGGAAAGGATGGCTCAAAAATTCAGCCTTTCCC
ATATAGAACGCATGGAAGGATCATGAGTCCTGTTCTATTGCTTGACATGAGCAAACATGA
TGAAAAGTCTAAAGGCCTCACCCTTGCTACTACATCCTTTGATGGTTACTTGTATTTGAT
TGAGGGCTCAAGTGGCTGTGCAGATGTTGTTGACATTGGAGAGACCTCGTACAGTATGGT
TTTGGCTGATAATGTTGATGGTGGAGATGACCTCGATCTTATTGTTACTACCATGAATGG
CAATGTCTTCTGCTTCTCCACTCCCTCTCCGCACCATCCACTTAAGGAATGGAGATCATC
AAACCAGGGAAGAAACAATGCTGCATATCGTTACAACCGTGAAGGTATTTATGTTAAACA
CGGTTCCAGAACATTCCGTGACGAAGAGGGCAAGCATTTCTGGGTAGAGTTTGAGATTGT
GGACAAGTACAGGGTTCCTTATGGGAACCAAGCTCCTTATAACGTGACGGTTACTCTACT
TGTCCCTGGGAATTATCAAGGAGAAAGGCGCATTGTGGTTAATGCAGCTTATAATGAACC
AGGCAAGCAGCGGATGAAGCTTCCCACAGTTCCTGTGAGAACCACAGGAACTGTGCTTGT
GGAAATGGTTGACAAAAACGGGTTCTACTTCTCTGACGAGTTCTCGCTCACCTTCCACAT
GCATTATTACAAGCTTCTGAAATGGCTCGTGCTTCTTCCAATGCTTGGGATGTTTAGCGT
TCTTGTCATCCTGCGGCCACAAGAAGGCGCTCCGTTGCCATCATTTTCAAGGAATATTGA
TTAGTGATTTGCACAGTGAAACGTCAGGTCCTCATAGAAGCAGATAAGCAGAACAAGATA
TTAGCAGGATATCCAATCACCCATGAAGGAGCTTGTCCACATCATACTGCATCGGGGAGC
TCAATCTGCACAGAAAAAACCCCTCACGATGCTGCATCCCATCAGTTAGCTAGTTCGGGA
AGTACAGCTTTTAGTCATGCAAAAAGAATTTTGTCACACTTGAGATTGTTTTCTAACTTA
TGATATTTACACAAGGAACTGGCAGCTGTCTGATCCTGGTTTAACATCTTGAGAATTTTA
GCCCCAGATATGCTATCAATCTTTCTTGCACC

CDS

2556 bp

>Os03t0825700-01 Ca2+ binding protein, Regulation of tapetal cell degradation and pollen formation
ATGCGTCCCCTCCTCGCCTTCGCGGCGGTATGCGCCCTTCTCGTGGCTGCCGCAGCGCCG
GCGGCCGCGGAGGAGGAGAAGGCGAACAAGTTCCGGCAGCGCGAGGCCACCGACGACATG
CTTGGATACCCCCACCTTGATGAAGATGCTTTATTGAAGACCAAGTGTCCAAAACATGTA
GAGCTGAGATGGCAGACTGAAGTTAGTTCCAGCATTTATGCAACTCCGTTGATCGCTGAT
ATCAACAGCGATGGAAAGTTGGAAGTAGTGGTGCCATCATTTGTTCATTACCTGGAAGTT
CTTGAAGGCTCTGATGGGGACAAATTGCCAGGATGGCCTGCATTTCACCAGTCAAATGTT
CATTCAAGTCCACTTCTATATGATATTGACAAGGACGGGACACGGGAAATAGTTTTGGCA
ACTTACAATGGTGTAGTGAATTTCTTCAGGGTATCAGGTTATATGATGATGGACAAGCTA
GAAGTACCTCGTAGGAAGGTACACAAAGACTGGTATGTTGGGCTGAATACAGATCCCGTT
GACCGCTCCCATCCAGATGTTCATGACAGCTCAATTGCAAAGAAAGCTGCTTCTGAAGAA
TCTCACCCAAATATTCAGGACAAGCCAGTTGTGAATGAATCTTCTAAGGAATCCCAGTCA
CGGAGCACAAATGACTCAACAACACGAGGAGTTGATTCCATGAAACATGCGTCTAAGGAA
GAGCCAGTTGAAAGTAAACCTAATTCTACCCGAGGACAGGAGAATATGGATGTGTTAAAC
AATCTAAACAGCACAGATGCTGGGAACAACTCTAGTTTAAGTACTACAACAGAGAATGCA
TCACATGTTCAGAGAAGGTTGCTTCAAACAGATGAGAAAAGTAATCAAGCAGGAAGCTCA
GAAACTGATGCAAGTGATACCGGAACAGCAAAAGCAGCTACTGTTGAAAATAGCGAGCCT
CTAGAGGCTGATGCTGATGCATCATTTAATTTGTTTCGGGATGTAGAAGATCTGCCTGAT
GAGTACAATTACGATTATGATGACTACGTTGATGAAACCATGTGGGGAGACGAGGACTGG
AAAGAACAACAACATGAAAAGGCAGAAGATTATGTGAGCATAGATGCTCACATCTTGTCC
ACCCCAGTGATTGCAGATATTGACAGAGATGGCATACAAGAAATGGTGATTTCTGTATCT
TACTTCTTTGACCACGAGTATTATGATAAACCAGAACATCTAAAGGAGTTAGGAGGGATT
GACATTGGCAAATATATTGCAAGCAGTATAGTTGTTTTTAACCTTGACACAAGACAAGTC
AAATGGACTGCAGAACTTGATTTGAGTACAGATAGTGGAAATTTTACTGCCCATGCATAT
TCTTCGCCGACCGTGGTTGATTTGGATGGTGATGGAAATTTGGATATTCTTGTTGGAACT
TCCTTTGGCTTGTTTTATGTTATCGATCATCGTGGTAAGGTTAGGAACAAGTTCCCACTT
GAGATGGCGGAGATTCATGCACCAGTCATTGCAGCAGATATCAATGATGATGGGAAAATC
GAGATGGTCACTGCTGATGTCCATGGCAATGTAGCAGCATGGACTGCAGAGGGAGAAGAA
ATCTGGGAGGTTCATCTTAAGAGTCTTATCCCACAGCGCCCTACTGTTGGTGATGTTAAT
GGAGATGGTCGCACTGAAGTTGTGGTCCCAACCGTGTCAGGAAACATATATGTTCTTAGT
GGAAAGGATGGCTCAAAAATTCAGCCTTTCCCATATAGAACGCATGGAAGGATCATGAGT
CCTGTTCTATTGCTTGACATGAGCAAACATGATGAAAAGTCTAAAGGCCTCACCCTTGCT
ACTACATCCTTTGATGGTTACTTGTATTTGATTGAGGGCTCAAGTGGCTGTGCAGATGTT
GTTGACATTGGAGAGACCTCGTACAGTATGGTTTTGGCTGATAATGTTGATGGTGGAGAT
GACCTCGATCTTATTGTTACTACCATGAATGGCAATGTCTTCTGCTTCTCCACTCCCTCT
CCGCACCATCCACTTAAGGAATGGAGATCATCAAACCAGGGAAGAAACAATGCTGCATAT
CGTTACAACCGTGAAGGTATTTATGTTAAACACGGTTCCAGAACATTCCGTGACGAAGAG
GGCAAGCATTTCTGGGTAGAGTTTGAGATTGTGGACAAGTACAGGGTTCCTTATGGGAAC
CAAGCTCCTTATAACGTGACGGTTACTCTACTTGTCCCTGGGAATTATCAAGGAGAAAGG
CGCATTGTGGTTAATGCAGCTTATAATGAACCAGGCAAGCAGCGGATGAAGCTTCCCACA
GTTCCTGTGAGAACCACAGGAACTGTGCTTGTGGAAATGGTTGACAAAAACGGGTTCTAC
TTCTCTGACGAGTTCTCGCTCACCTTCCACATGCATTATTACAAGCTTCTGAAATGGCTC
GTGCTTCTTCCAATGCTTGGGATGTTTAGCGTTCTTGTCATCCTGCGGCCACAAGAAGGC
GCTCCGTTGCCATCATTTTCAAGGAATATTGATTAG

Protein

852 aa

>Os03t0825700-01 Ca2+ binding protein, Regulation of tapetal cell degradation and pollen formation
MRPLLAFAAVCALLVAAAAPAAAEEEKANKFRQREATDDMLGYPHLDEDALLKTKCPKHV
ELRWQTEVSSSIYATPLIADINSDGKLEVVVPSFVHYLEVLEGSDGDKLPGWPAFHQSNV
HSSPLLYDIDKDGTREIVLATYNGVVNFFRVSGYMMMDKLEVPRRKVHKDWYVGLNTDPV
DRSHPDVHDSSIAKKAASEESHPNIQDKPVVNESSKESQSRSTNDSTTRGVDSMKHASKE
EPVESKPNSTRGQENMDVLNNLNSTDAGNNSSLSTTTENASHVQRRLLQTDEKSNQAGSS
ETDASDTGTAKAATVENSEPLEADADASFNLFRDVEDLPDEYNYDYDDYVDETMWGDEDW
KEQQHEKAEDYVSIDAHILSTPVIADIDRDGIQEMVISVSYFFDHEYYDKPEHLKELGGI
DIGKYIASSIVVFNLDTRQVKWTAELDLSTDSGNFTAHAYSSPTVVDLDGDGNLDILVGT
SFGLFYVIDHRGKVRNKFPLEMAEIHAPVIAADINDDGKIEMVTADVHGNVAAWTAEGEE
IWEVHLKSLIPQRPTVGDVNGDGRTEVVVPTVSGNIYVLSGKDGSKIQPFPYRTHGRIMS
PVLLLDMSKHDEKSKGLTLATTSFDGYLYLIEGSSGCADVVDIGETSYSMVLADNVDGGD
DLDLIVTTMNGNVFCFSTPSPHHPLKEWRSSNQGRNNAAYRYNREGIYVKHGSRTFRDEE
GKHFWVEFEIVDKYRVPYGNQAPYNVTVTLLVPGNYQGERRIVVNAAYNEPGKQRMKLPT
VPVRTTGTVLVEMVDKNGFYFSDEFSLTFHMHYYKLLKWLVLLPMLGMFSVLVILRPQEG
APLPSFSRNID*

5'UTR

chr03:34680009..34680156 (+ strand) : 148 bp

CDS

chr03:34680157..34680293 (+ strand) : 137 bp

chr03:34681892..34682002 (+ strand) : 111 bp

chr03:34682411..34682493 (+ strand) : 83 bp

chr03:34682701..34682818 (+ strand) : 118 bp

chr03:34682917..34683128 (+ strand) : 212 bp

chr03:34683581..34684065 (+ strand) : 485 bp

chr03:34684145..34684215 (+ strand) : 71 bp

chr03:34684607..34684863 (+ strand) : 257 bp

chr03:34685234..34685411 (+ strand) : 178 bp

chr03:34685763..34686050 (+ strand) : 288 bp

chr03:34686139..34686256 (+ strand) : 118 bp

chr03:34686988..34687170 (+ strand) : 183 bp

chr03:34687262..34687576 (+ strand) : 315 bp

3'UTR

chr03:34687577..34687904 (+ strand) : 328 bp

FASTA

>Os03t0825700-01 class=Sequence position=chr03:34680009..34687904 (+ strand)
GTCTCTTTCG CCATTTCGGA TTCCCCACCC GACGAGTCTC CGACCACTTC CCACACCGGC GCCTCCACGC CGAGATCTCC
TTCCCTCTCC ACCGCCGGCG ACCGCCGCGG CGCGGCGAGG CCCTCGGGGT CTAGGGTTTT GTACTCAGAT GCGTCCCCTC
CTCGCCTTCG CGGCGGTATG CGCCCTTCTC GTGGCTGCCG CAGCGCCGGC GGCCGCGGAG GAGGAGAAGG CGAACAAGTT
CCGGCAGCGC GAGGCCACCG ACGACATGCT TGGATACCCC CACCTGTGAG TCACCGCTTG CCTCTCTCCT TCACATGGGT
TCTCCTGTCG CTTTCGATTT GGAACTGAAC TGCTGCTAGA TCCTTGGGAC TGGAAGCGAT CTTAGATGGT TGGTTGTTTT
CTGTGGCTCC TCGTAATTTC TTAGTAGTTA ACGACCTTAA TCACCTTATT ATTTCTGTAG GAGTGTTCAA TTTATGCTCA
GAATGACACG ATGTGCAGAA TCTGTTAAAA CCTCTACACT TTTTTTTTTG CATTGGAAAA TACTTCTACT TCATTCGAGC
ATTGATGTAT CAGGGATTAC ACAAAGCAAT TAACTCATTT TATGGAATAG TTAATTTGAA TATGGAAATG GTGATTTCGT
CCTTCTTTTC ATTTAGGTCA CCCAATCTAG TGTTTCATAA TCTGGATTTG TTTCAACTGT TATGCAGGCT TGTGTTTCAT
AATCTGGATT TGTTTCAACT GTCATGCAGG CTAATGTCAC AAAAAAGAAG AATATATGCA ATTTCTAGAG TGTGAAGATT
TACTCTTCTT TTTAAAAAAC TTGGATCGCT TAATTTTTGT TCCATTTAAT GGGCACATAT GATACATGTG GTGATTGATA
CCCTGCATTA AGTAATAGGC CTTATTGGGA TTAGCGTATT TGTGACCAAC CATACTATGC CTGGCAGATT TGTTCATTCA
GTTGATTCTT TGTAGTGTGA AATTATTATT ATATTCTCTT GTATCTTAAA AGAATTAGTA CTCACTGATC CCCTCCACCA
CCCACATACA ATAAAATCTA CATTTATAAT TGGTTCTGTA GGTAAAAATG GATGTAAAAT CTGTACATCG CTTGAGGTTT
CTAGATCAGT TATTGTAGTT CTGTTGTTTT TGCGAGTGCT GTAAAAGCGC AAACAGCTCT TCAGATGTGT TCCCTTCAGA
GTTAATCTTA GTGTCCTTTG AAATAGATTT GATCATATAT CCTCTCTTTA GATAAAAAAA AAGAGTATTA AACCTCCTGT
GCCACTGACA TATAGGGTCA TCTAAGGTCA CTGACATGTA GACTGAAGGG TAAATCCTCA ATTTCAATCT AAAAGCAGGT
ATATGATCAA TCATTACTTG AATCTTTGAT ACCATTTCAC TGTCAACCTG AATTTCATTG GCGTGCTAAT TCTTAAAATA
TCTGCACAAA TATATATGAT ATATTAGTCA GCCATACAGG GGGCAAAAAA GCATTCCTGT TAAATATAAA TTCTTATTGA
TGTTTTCATC TGCAAAAAGG ATTAAGAGAT TAAGAGTAAG ATTGGCTGTT ACAACATGTG GATCATCAAA TTGTTATACT
GTAGTATTGT AGTTTCTCAG AGAAAAATCA CAGCCTAAAG CATAATGCAT TTATCCATAC CACTAATTTC AACTGAGCAC
CTGCAAAATG CCACAACTTA TGGAGCAAGT TTATTAATTC AGTTAGCTAC CATGATCCCC GTGTTTTCAA TTTGTTCAGG
GGGACATATG AAAGATTTTA CTATTGTGGA CACTACATCT TTGAAAGTTA CCTAGACAAA TAATGTTGAT CATCTGTACG
GATAGATGCA TTCATCGATG TAATAACTAT ATATTCTCCG CAGTGATGAA GATGCTTTAT TGAAGACCAA GTGTCCAAAA
CATGTAGAGC TGAGATGGCA GACTGAAGTT AGTTCCAGCA TTTATGCAAC TCCGTTGATC GCTGATATCA ACAGGTAAAA
TATCCTGGGA AATGATTTGG CTTTTTTTTG GCTTTAGGAC ATGTTAATCT TTGTCAGATA TCCTTCTCAT TATCTTCTTC
TATTTGACTT CATGTTTCCA TCATTATTTG CTTGTATAAA GATAAATCTA TTGTTCTATG CTCTGGAACA GCATCCACTT
CTGAATAAAC CTTCTGTTAG TTACTATAGA TTATGTTCAA AATCAAATAA GTACATCATT GCCATAAACT GAATTTTTTT
TCCTCTGTAT GATTTTGTGC TTCAAACTAT GGACACTGTG AAATATCATA TGCATGTTTG CTTTGGATTT TTAAACGTGG
ATGACTTTTT TCTAGTTATT GTCTTAATTT CTTCTTTAGT CTGCTCTGGG CACACTTTAA TGATAATCTT TTGGTGTATT
AGCGATGGAA AGTTGGAAGT AGTGGTGCCA TCATTTGTTC ATTACCTGGA AGTTCTTGAA GGCTCTGATG GGGACAAATT
GCCAGGTGTG TGGTTTCACA TTACCGATTA GCATGTTATA GTGGTCATCA TTAGCTCTTT GCTATAAATT CTGGAAAACC
ATCAATTGAA TGAATAGGTC TAAGATGTTC TACCACATTT TAAAGGTCCT GAAAGTTTGT GCTATAATTA ACAAAAGAAT
TGGTTTAATG TTGTTTATTT ATTAATATAT ATTGTTGTGA AATTGATTCC AGGATGGCCT GCATTTCACC AGTCAAATGT
TCATTCAAGT CCACTTCTAT ATGATATTGA CAAGGACGGG ACACGGGAAA TAGTTTTGGC AACTTACAAT GGTGTAGTGA
ATTTCTTCAG GTAAGGAACT TGGTGCATAT CTTCTTATGT TTTCACTGAA CATGTAAAAT TATTTGTTGA GTTTGTTTGA
CATGGTAATT TATTTGTTTG TTATGTAGGG TATCAGGTTA TATGATGATG GACAAGCTAG AAGTACCTCG TAGGAAGGTA
CACAAAGACT GGTATGTTGG GCTGAATACA GATCCCGTTG ACCGCTCCCA TCCAGATGTT CATGACAGCT CAATTGCAAA
GAAAGCTGCT TCTGAAGAAT CTCACCCAAA TATTCAGGAC AAGCCAGTTG TGAATGAATC TTCTAAGGAA TCCCAGTCAC
GTAAGTTATC TTATAAGCTA TAATCACACT ATTCACTGGT CAATCATAAG AATCCCTTCT TTTCATCTGT TGCTTTAGTA
GTTTGGCTGC AATGCTTATT CTCTAGTCAC TAGTATTTTA CATGCTCTAC CTTGAAAGTC TGTGGCTCTG CGCGCTGTTT
AGGTTAAATG GTACTTTAGG ATCATTAGTT CAATATTGAT GTTTGTTGAA CATATTTGTA GGCTGTCCTT AGATATATAG
ATAATACAGT GGAGCCTGGA TATTATAACT AGATTATGTG ATGTTACCAA CCAGAGGATG GAAAATGCTC TAAAGAGAGT
GGTGCATGCA CGTAGTAACG ATTATGCTAC TCCAGTACTC TGATTTTAGT AACAGAGAAT CCACACTCCG TGTGTAGTCT
ATAAGATCAT TTACAAGAGA TGCATTATAG TTTTATTTGT TTATCACTGT AGGGAGCACA AATGACTCAA CAACACGAGG
AGTTGATTCC ATGAAACATG CGTCTAAGGA AGAGCCAGTT GAAAGTAAAC CTAATTCTAC CCGAGGACAG GAGAATATGG
ATGTGTTAAA CAATCTAAAC AGCACAGATG CTGGGAACAA CTCTAGTTTA AGTACTACAA CAGAGAATGC ATCACATGTT
CAGAGAAGGT TGCTTCAAAC AGATGAGAAA AGTAATCAAG CAGGAAGCTC AGAAACTGAT GCAAGTGATA CCGGAACAGC
AAAAGCAGCT ACTGTTGAAA ATAGCGAGCC TCTAGAGGCT GATGCTGATG CATCATTTAA TTTGTTTCGG GATGTAGAAG
ATCTGCCTGA TGAGTACAAT TACGATTATG ATGACTACGT TGATGAAACC ATGTGGGGAG ACGAGGACTG GAAAGAACAA
CAACATGAAA AGGCAGAAGA TTATGTGAGC ATAGATGCTC ACATCTTGTC CACCCCAGTG AGTGTACCTT CTGTTTCGTT
TTGGCTATTT CTGCTTGTTC ATTCTATAAA TATTCATGAA TTATTTTCCA CTACAGGTGA TTGCAGATAT TGACAGAGAT
GGCATACAAG AAATGGTGAT TTCTGTATCT TACTTCTTTG ACCACGAGTA AGGCTGCTTT CTCTGCTACA AGTGCATTTT
GATAACATAA CAAAATATAC TGGTTATTTA TGTTATCATG TGATGACATT TGTTGTTATG TAGTTTAGGT TACTTTTTTA
AAACCAGAAT CCTTTTATTC TCCCTGATTT TGGGTCGGTT GGTATGTGGT GGTGCTTTAT GACAGTTTTC ACTTCTCAGT
TAGGTTCCAA CAATGAATCA AAATATGCCG ACCTAAGGTG TTTGCTTGTA ATTTCCCTTC TGTCTATTGG TTATGATTGA
AATACTCTCT CAATGCAAAA CTTGTGACCA TAATATGACT TAATGATTTC TTGCCTAATT CCTGTGTTGT TGTGTTGGTG
TTTCAGACAG TCACTAGTAA CTTGTCTTTT ACTGACAGGT ATTATGATAA ACCAGAACAT CTAAAGGAGT TAGGAGGGAT
TGACATTGGC AAATATATTG CAAGCAGTAT AGTTGTTTTT AACCTTGACA CAAGACAAGT CAAATGGACT GCAGAACTTG
ATTTGAGTAC AGATAGTGGA AATTTTACTG CCCATGCATA TTCTTCGCCG ACCGTGGTTG ATTTGGATGG TGATGGAAAT
TTGGATATTC TTGTTGGAAC TTCCTTTGGC TTGTTTTATG TTATCGATCA TCGTGGTAAA TTCTTAACCT CATAATATCA
ATTCTGAATC CATAAACAGC TTTAAGCTGA CTTATTGTTT TCTATGCTGT GTATATCTAG CTCCCGTAGC ATAAAGTTTT
TTTTTTCTAG AACAACAGAA TATGTTAGTG TAGAAGTAAC AGTATGTTTC AGCATGCTTT TCTTTGCTTT GTTTGGACAA
TAAGGACATG TTCACTGAAA ATCCTCACAA ATACAATAAA ATCTCACTTT CAGTTCTGTT GCTTTCATCA ATATGTTTCA
GCATGCTTCT CTTTGCTTCG TTTGGATAAT TAGGACATGT TCACTGAAAA TCCTCACAAA TACAATATAT TCTCACCATA
AGTGCTGTTG ATTTTATCAA TCTAGGTAAG GTTAGGAACA AGTTCCCACT TGAGATGGCG GAGATTCATG CACCAGTCAT
TGCAGCAGAT ATCAATGATG ATGGGAAAAT CGAGATGGTC ACTGCTGATG TCCATGGCAA TGTAGCAGCA TGGACTGCAG
AGGGAGAAGA AATCTGGGAG GTTCATCTTA AGAGTCTTAT CCCACAGGCA AGTTCAAACC CGTTTCTTTT GTGGGTTCTA
ACTGATTGTG TATATATTTT TGGTTGTCTA TCTATATCTA AACATACCCT TACCTTTGGC AGTCTATGGA CTGCAAATTG
CTATATGTCC TGAAGCTGCT TGCTTGTTTA GCTCGGTAGA ATACTATGGA ATCTTTCTTG TCAGATTGTC ACAATTTATT
TCCATCTTGT TCTATTACCT TTTTACCGAG TCAGAAATCA GAATATCATA ACTTGGTTTA GTATTACTAT ATGCTTTCAC
TGTCTTCACT GGTGCATTCA GTTTTATTTG GGCTATGCTT TTCATACCCT CTGATTTGCC ATTGTCATAT GATGACAGCG
CCCTACTGTT GGTGATGTTA ATGGAGATGG TCGCACTGAA GTTGTGGTCC CAACCGTGTC AGGAAACATA TATGTTCTTA
GTGGAAAGGA TGGCTCAAAA ATTCAGCCTT TCCCATATAG AACGCATGGA AGGATCATGA GTCCTGTTCT ATTGCTTGAC
ATGAGCAAAC ATGATGAAAA GTCTAAAGGC CTCACCCTTG CTACTACATC CTTTGATGGT TACTTGTATT TGATTGAGGG
CTCAAGTGGC TGTGCAGATG TTGTTGACAT TGGAGAGACC TCGTATGACA TTTCTTGTCT GCTTTGCAAT TCTGTACTCT
GTACAATTTC TGGATTCAAC AAAGTGGCTC ACTTCTTTGC ATATTGACAG GTACAGTATG GTTTTGGCTG ATAATGTTGA
TGGTGGAGAT GACCTCGATC TTATTGTTAC TACCATGAAT GGCAATGTCT TCTGCTTCTC CACTCCCTCT CCGCACCATC
CACTTAAGGT ACATAGCATG TTTTTTTATG TCAATAATTT Agagtaaatt acacaaaacc ataggtattg tgtccaagtt
acacaaaacc acaggagttt tggcacgtgg catagaaccc ctattgttat gttaccaatg tttcagaaaa ccacacaatt
gccaaatttt tcttaaattt gacatgtggg atgaaacttt tatatgctca tagaaccacg gtggatgaaa gaactcataa
tcccacgtca gatttgggtc aaatcatgtt cagatttggg tcaaattggt caattgcatg gttttgtgaa acactaacac
cataataccc atggttacgt gccacgtgtc aaaactcacg tgattttgtg catactcata atttaactca agtcagtaga
tttttttgtg aaTCCTCCGT AACTTATGTT TAATCTGGTT TGGCTGAGAG TTGCATATTT CCTTTAAACC TTATATTTTT
TATGGATGTT GAAACAAGAT AGTGGAAGTA CTGCTGACAA TAGGATAACA AAATCACGTG ATTTTGTGCA ATTTACTCAT
AATTTAACTC AAGTCAGTAG ATTTTTTGGT GAATCCTCCG TAACTTATGT TTAATCTGGT TTGGCTGAGA GTTGCATATT
TCCTTTAAAC CTTCTATTTA TTCATGGATG TTTAAACAAG ATAGTGGAAG TACTGCTGAC AGTAGGATAA CAATATAATT
CCTTCCAATT TAATGGTAGG AATGGAGATC ATCAAACCAG GGAAGAAACA ATGCTGCATA TCGTTACAAC CGTGAAGGTA
TTTATGTTAA ACACGGTTCC AGAACATTCC GTGACGAAGA GGGCAAGCAT TTCTGGGTAG AGTTTGAGAT TGTGGACAAG
TACAGGGTTC CTTATGGGAA CCAAGCTCCT TATAACGTGA CGGTACATTT TGTCAACCCA ATGGCTTGTC TGATGGATAT
TCCAAATATT TTTATTTAAC TTCCAACTAC CCTCGCTTAC CATTGGATTT CAGGTTACTC TACTTGTCCC TGGGAATTAT
CAAGGAGAAA GGCGCATTGT GGTTAATGCA GCTTATAATG AACCAGGCAA GCAGCGGATG AAGCTTCCCA CAGTTCCTGT
GAGAACCACA GGAACTGTGC TTGTGGAAAT GGTTGACAAA AACGGGTTCT ACTTCTCTGA CGAGTTCTCG CTCACCTTCC
ACATGCATTA TTACAAGCTT CTGAAATGGC TCGTGCTTCT TCCAATGCTT GGGATGTTTA GCGTTCTTGT CATCCTGCGG
CCACAAGAAG GCGCTCCGTT GCCATCATTT TCAAGGAATA TTGATTAGTG ATTTGCACAG TGAAACGTCA GGTCCTCATA
GAAGCAGATA AGCAGAACAA GATATTAGCA GGATATCCAA TCACCCATGA AGGAGCTTGT CCACATCATA CTGCATCGGG
GAGCTCAATC TGCACAGAAA AAACCCCTCA CGATGCTGCA TCCCATCAGT TAGCTAGTTC GGGAAGTACA GCTTTTAGTC
ATGCAAAAAG AATTTTGTCA CACTTGAGAT TGTTTTCTAA CTTATGATAT TTACACAAGG AACTGGCAGC TGTCTGATCC
TGGTTTAACA TCTTGAGAAT TTTAGCCCCA GATATGCTAT CAATCTTTCT TGCACC