Os03t0826600-01

Locus

Os03g0826600

Description

Similar to Phospholipase (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NPC1

CGSNL Gene Name

NON-SPECIFIC PHOSPHOLIPASE C1

Oryzabase Gene Symbol Synonym(s)

OsNPC1

Oryzabase Gene Name Synonym(s)

Non-specific phospholipase C1

Transcript Evidence

AK101187 (DDBJ, Best hit)

AK067741 (DDBJ, Best hit)

Protein Evidence

B6U8P0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: hydrolase activity, acting on ester bonds (GO:0016788)

Functional domain (InterPro)

Phosphoesterase (IPR007312)

Full-length cDNA

J033030C17 (Online Clone Ordering)

J013116N13 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0826600-01)

RiceXPro (AK101187)

Others

Oryzabase (21048)

KEGG (Os03t0826600-01)

Transcript

2129 bp

>Os03t0826600-01 Similar to Phospholipase (Fragment).
AAAGAAGAGGAGAGGAGACACGCAAAAGCAAAGCAAACCACTCGCCGAACACCAACTCCT
CGCCGCCGCCGCCGAGGAGGAGGAGGAGGGAGCGAGCTTGACGCCGGCGCCATGGCGGGC
GGGGGAGGTAGGGAGCGGCGCGGCGGGGGGAGGCTGCTCGTCGGGGTGCTGCTCCTGACG
CTGGTGGTGTCCGGGCACTGCCTGGAGAGCACGCACCACCGCGGGCTGAAGCGGCGGCGG
CGgaagcacgagatccactcgccgatcaagacggtggtggtggtggtgatggagaatcgg
agcttcgaccacatcctcgggtggctcagccgcacccgccccgacATCGACGGGCTCAAC
GGCACGCAATCCAACCGCCTCAACGCCTCCGACCCTTCCTCCCCGGAGATCTTCGTCACC
GACGAGGCcggctacgtcgactccgaccccggccacggcttcgaggacatccgcgagcag
atcttcggctccgccgacacctccgccgtgccggcccccatgtccggcttcgcccagaac
gcccgcgggatgggcctcggcatgccgcagaacgtcatgagcgggttcaagccggagtcc
gtgccggtctacgccgccctcgccgacgagttcgccgtgttcgaccggtggttcgcctcc
gtgcccaccTCCACCCAGCCCAATCGCCTCTACGTCCATTCCGCGACCTCCCATGGCCTC
ACCTTCAATGCCCGCAAGGACCTCATCCATGGCTTCCCGCAGAAGACCATCTTCGATAGC
CTCGAGGAGAACGGCTTGTCCTTTGGCATCTACTACCAGAACATCCCGGCCACGCTCTTC
TACCAGAGCCTCCGCCGCCTCAAGCACCTCGTCAAGTTCCACCAGTACAGCCTCAAGTTC
AAGCTTCACGCCAAGTGGGGAAAGCTGCCGAATTACGCGGTGATTGAGCAGAGGTACTTC
GATTGCGAGATGTTCCCTGCAAACGATGACCACCCCTCGCACGACGTAGCGAGGGGGCAG
AGGTTCGTCAAGGAGGTGTATGAGACGCTGCGAGCGAGTCCGCAGTGGAACGAGACTGCT
CTGATCATCACCTATGATGAGCATGGTGGATTCTATGACCATGTGCCTACGCCGGTTGTC
GGGGTTCCACAGCCTGATGGAATTGTTGGCCCTGATCCTTACTACTTCAAGTTTGATCGG
CTTGGAGTGCGCGTGCCTTCTTTCCTTATCTCACCATGGATCGAGAAGCGCACTGTGATC
CATGAACCAAATGGGCCGCAGGACTCCTCACAATATGAGCACTCATCCATCCCTGCAACA
GTAAAGAAGCTATTTAATTTACATTCTAACTTCCTGACAAAGAGGGATGCATGGGCTGGG
ACCTTTGAGAACTACTTCAAAATCCGGAAAACACCCAGAACTGATTGTCCAGAGAAACTC
CCAGAGGTCACAAAGTCTCTGCAACCGTTTGGCCCTAAGGAAGATTCATCTCTGTCAGAG
TTTCAAGTGGAGTTGATTCAGCTTGCTTCTCAGCTCAATGGTGACCATGTACTCAACACC
TACCCAGATATTGGCAGGACTATGACTGTGGGTGAAGCAAACCGCTATGCAGAGGATGCT
GTTGCTAGATTTTTGGAAGCTGGCAGGATTGCTCTAAGAGCTGGTGCAAATGAATCTGCT
TTGGTCACCATGAGGCCTGCACTCACCAGCAGAGCCTCACCGTCCTCTGATTTATCATCT
GAACTCTGATGGATTGTTCTCAGATTTATCCACAATTCTGCATCATGATTTGCACCGCGT
CAGCTTTTGGTTGATGAGAACTCGTACAATGTGCTAAGAAAACATAGGTAGGTTGGTGTA
CGGCAAAGTGTGCTAGTATTATGTAATTGATAGATCTTAAACATGGCTTTGTACATAGAC
ATCATGATACTTGATATCTCAAGCTTTTACTTCAGCTGTCCTCTGATAACGCTGAGATAT
CAGCTCAGAAGTATCTGATAAGATCCTACTCTGGATAAGCTGGAGAGGGAATTTGTAAAC
CATCGATATTCAGCTCTGTACCTGCTTATTCAGCAGTTGAACTGCACTTCTGATGAAATA
CTTTATGTACACCAGTTATAGTGGTATTG

CDS

1638 bp

>Os03t0826600-01 Similar to Phospholipase (Fragment).
ATGGCGGGCGGGGGAGGTAGGGAGCGGCGCGGCGGGGGGAGGCTGCTCGTCGGGGTGCTG
CTCCTGACGCTGGTGGTGTCCGGGCACTGCCTGGAGAGCACGCACCACCGCGGGCTGAAG
CGGCGGCGGCGgaagcacgagatccactcgccgatcaagacggtggtggtggtggtgatg
gagaatcggagcttcgaccacatcctcgggtggctcagccgcacccgccccgacATCGAC
GGGCTCAACGGCACGCAATCCAACCGCCTCAACGCCTCCGACCCTTCCTCCCCGGAGATC
TTCGTCACCGACGAGGCcggctacgtcgactccgaccccggccacggcttcgaggacatc
cgcgagcagatcttcggctccgccgacacctccgccgtgccggcccccatgtccggcttc
gcccagaacgcccgcgggatgggcctcggcatgccgcagaacgtcatgagcgggttcaag
ccggagtccgtgccggtctacgccgccctcgccgacgagttcgccgtgttcgaccggtgg
ttcgcctccgtgcccaccTCCACCCAGCCCAATCGCCTCTACGTCCATTCCGCGACCTCC
CATGGCCTCACCTTCAATGCCCGCAAGGACCTCATCCATGGCTTCCCGCAGAAGACCATC
TTCGATAGCCTCGAGGAGAACGGCTTGTCCTTTGGCATCTACTACCAGAACATCCCGGCC
ACGCTCTTCTACCAGAGCCTCCGCCGCCTCAAGCACCTCGTCAAGTTCCACCAGTACAGC
CTCAAGTTCAAGCTTCACGCCAAGTGGGGAAAGCTGCCGAATTACGCGGTGATTGAGCAG
AGGTACTTCGATTGCGAGATGTTCCCTGCAAACGATGACCACCCCTCGCACGACGTAGCG
AGGGGGCAGAGGTTCGTCAAGGAGGTGTATGAGACGCTGCGAGCGAGTCCGCAGTGGAAC
GAGACTGCTCTGATCATCACCTATGATGAGCATGGTGGATTCTATGACCATGTGCCTACG
CCGGTTGTCGGGGTTCCACAGCCTGATGGAATTGTTGGCCCTGATCCTTACTACTTCAAG
TTTGATCGGCTTGGAGTGCGCGTGCCTTCTTTCCTTATCTCACCATGGATCGAGAAGCGC
ACTGTGATCCATGAACCAAATGGGCCGCAGGACTCCTCACAATATGAGCACTCATCCATC
CCTGCAACAGTAAAGAAGCTATTTAATTTACATTCTAACTTCCTGACAAAGAGGGATGCA
TGGGCTGGGACCTTTGAGAACTACTTCAAAATCCGGAAAACACCCAGAACTGATTGTCCA
GAGAAACTCCCAGAGGTCACAAAGTCTCTGCAACCGTTTGGCCCTAAGGAAGATTCATCT
CTGTCAGAGTTTCAAGTGGAGTTGATTCAGCTTGCTTCTCAGCTCAATGGTGACCATGTA
CTCAACACCTACCCAGATATTGGCAGGACTATGACTGTGGGTGAAGCAAACCGCTATGCA
GAGGATGCTGTTGCTAGATTTTTGGAAGCTGGCAGGATTGCTCTAAGAGCTGGTGCAAAT
GAATCTGCTTTGGTCACCATGAGGCCTGCACTCACCAGCAGAGCCTCACCGTCCTCTGAT
TTATCATCTGAACTCTGA

Protein

546 aa

>Os03t0826600-01 Similar to Phospholipase (Fragment).
MAGGGGRERRGGGRLLVGVLLLTLVVSGHCLESTHHRGLKRRRRKHEIHSPIKTVVVVVM
ENRSFDHILGWLSRTRPDIDGLNGTQSNRLNASDPSSPEIFVTDEAGYVDSDPGHGFEDI
REQIFGSADTSAVPAPMSGFAQNARGMGLGMPQNVMSGFKPESVPVYAALADEFAVFDRW
FASVPTSTQPNRLYVHSATSHGLTFNARKDLIHGFPQKTIFDSLEENGLSFGIYYQNIPA
TLFYQSLRRLKHLVKFHQYSLKFKLHAKWGKLPNYAVIEQRYFDCEMFPANDDHPSHDVA
RGQRFVKEVYETLRASPQWNETALIITYDEHGGFYDHVPTPVVGVPQPDGIVGPDPYYFK
FDRLGVRVPSFLISPWIEKRTVIHEPNGPQDSSQYEHSSIPATVKKLFNLHSNFLTKRDA
WAGTFENYFKIRKTPRTDCPEKLPEVTKSLQPFGPKEDSSLSEFQVELIQLASQLNGDHV
LNTYPDIGRTMTVGEANRYAEDAVARFLEAGRIALRAGANESALVTMRPALTSRASPSSD
LSSEL*

5'UTR

chr03:34724328..34724438 (+ strand) : 111 bp

CDS

chr03:34724439..34725582 (+ strand) : 1144 bp

chr03:34726124..34726300 (+ strand) : 177 bp

chr03:34726545..34726861 (+ strand) : 317 bp

3'UTR

chr03:34726862..34727241 (+ strand) : 380 bp

FASTA

>Os03t0826600-01 class=Sequence position=chr03:34724328..34727241 (+ strand)
AAAGAAGAGG AGAGGAGACA CGCAAAAGCA AAGCAAACCA CTCGCCGAAC ACCAACTCCT CGCCGCCGCC GCCGAGGAGG
AGGAGGAGGG AGCGAGCTTG ACGCCGGCGC CATGGCGGGC GGGGGAGGTA GGGAGCGGCG CGGCGGGGGG AGGCTGCTCG
TCGGGGTGCT GCTCCTGACG CTGGTGGTGT CCGGGCACTG CCTGGAGAGC ACGCACCACC GCGGGCTGAA GCGGCGGCGG
CGgaagcacg agatccactc gccgatcaag acggtggtgg tggtggtgat ggagaatcgg agcttcgacc acatcctcgg
gtggctcagc cgcacccgcc ccgacATCGA CGGGCTCAAC GGCACGCAAT CCAACCGCCT CAACGCCTCC GACCCTTCCT
CCCCGGAGAT CTTCGTCACC GACGAGGCcg gctacgtcga ctccgacccc ggccacggct tcgaggacat ccgcgagcag
atcttcggct ccgccgacac ctccgccgtg ccggccccca tgtccggctt cgcccagaac gcccgcggga tgggcctcgg
catgccgcag aacgtcatga gcgggttcaa gccggagtcc gtgccggtct acgccgccct cgccgacgag ttcgccgtgt
tcgaccggtg gttcgcctcc gtgcccaccT CCACCCAGCC CAATCGCCTC TACGTCCATT CCGCGACCTC CCATGGCCTC
ACCTTCAATG CCCGCAAGGA CCTCATCCAT GGCTTCCCGC AGAAGACCAT CTTCGATAGC CTCGAGGAGA ACGGCTTGTC
CTTTGGCATC TACTACCAGA ACATCCCGGC CACGCTCTTC TACCAGAGCC TCCGCCGCCT CAAGCACCTC GTCAAGTTCC
ACCAGTACAG CCTCAAGTTC AAGCTTCACG CCAAGTGGGG AAAGCTGCCG AATTACGCGG TGATTGAGCA GAGGTACTTC
GATTGCGAGA TGTTCCCTGC AAACGATGAC CACCCCTCGC ACGACGTAGC GAGGGGGCAG AGGTTCGTCA AGGAGGTGTA
TGAGACGCTG CGAGCGAGTC CGCAGTGGAA CGAGACTGCT CTGATCATCA CCTATGATGA GCATGGTGGA TTCTATGACC
ATGTGCCTAC GCCGGTTGTC GGGGTTCCAC AGCCTGATGG AATTGTTGGC CCTGATCCTT ACTACTTCAA GTTTGATCGG
CTTGGAGTGC GCGTGCCTTC TTTCCTTATC TCACCATGGA TCGAGAAGCG CACTGGTAAG TACTTGTGCT GTTTGCATCT
ATTCCCTTTC AAGAAGTTAT TCCTTGAATT TTGATGTCTA TAAGTAAAGA CTATTGATTA GCGAACTTGT TAAGATTAGT
CTCTGTTAGT ATGAATTTTA CTGCAATATT CGAGGGAGAA TTTGTCATTC ATTCTCCACA GAAACATTCA TCGAGTAACA
TAGGTGTGTA GGCTAGGTAA TATAGACCGA GCCTTTGAGT TTCCATAGTA GATAACATTT CAAAAAGTTG CATATGAATA
AAAAAGTGCA AGACATTTTT AGCTAACTTG TTCTATGTAG CAAACATGAG TTCTATGTTT GCTCTTTGCT TGTAAAGTTG
TACTTGACAA ACCAAGGAAC TTGAACGTTG AACCACTGTA AGGCACAACT GTACAAGCAA AGAGCCAACT AGCATGTATC
ATGCTGTTTT ATGTTGGAAG GGCCAGTTGT GCCTTACACA ACCATAGAAA TATTTTAATG GTGTTCTGTT TTGTATATCT
CTTAGTATTA ACTGGTCTTG CTTTTCATTT CTGCAGTGAT CCATGAACCA AATGGGCCGC AGGACTCCTC ACAATATGAG
CACTCATCCA TCCCTGCAAC AGTAAAGAAG CTATTTAATT TACATTCTAA CTTCCTGACA AAGAGGGATG CATGGGCTGG
GACCTTTGAG AACTACTTCA AAATCCGGAA AACACCCAGA ACTGATTGTC CAGGTATATA GTTTTGTGTT CATTATGTTA
TTATTAGAAG ATATATGTAC TCTACTACAC CAATGCCATT TTGTTGACGC TGACAATTAT TTAGGGAAAG TATCACAAAG
TTCAGATATT GTAGAGCATT CTGTTCTGGA AGCTCCCAAT GCTTACAGTT GCTTATCAAT GCAGAGTTTT GGAACTTAGT
TAATTATTAC TGAAATTGCA TTGCAACCTA ATTATATATG TTATTGTTTC CTAACAGAGA AACTCCCAGA GGTCACAAAG
TCTCTGCAAC CGTTTGGCCC TAAGGAAGAT TCATCTCTGT CAGAGTTTCA AGTGGAGTTG ATTCAGCTTG CTTCTCAGCT
CAATGGTGAC CATGTACTCA ACACCTACCC AGATATTGGC AGGACTATGA CTGTGGGTGA AGCAAACCGC TATGCAGAGG
ATGCTGTTGC TAGATTTTTG GAAGCTGGCA GGATTGCTCT AAGAGCTGGT GCAAATGAAT CTGCTTTGGT CACCATGAGG
CCTGCACTCA CCAGCAGAGC CTCACCGTCC TCTGATTTAT CATCTGAACT CTGATGGATT GTTCTCAGAT TTATCCACAA
TTCTGCATCA TGATTTGCAC CGCGTCAGCT TTTGGTTGAT GAGAACTCGT ACAATGTGCT AAGAAAACAT AGGTAGGTTG
GTGTACGGCA AAGTGTGCTA GTATTATGTA ATTGATAGAT CTTAAACATG GCTTTGTACA TAGACATCAT GATACTTGAT
ATCTCAAGCT TTTACTTCAG CTGTCCTCTG ATAACGCTGA GATATCAGCT CAGAAGTATC TGATAAGATC CTACTCTGGA
TAAGCTGGAG AGGGAATTTG TAAACCATCG ATATTCAGCT CTGTACCTGC TTATTCAGCA GTTGAACTGC ACTTCTGATG
AAATACTTTA TGTACACCAG TTATAGTGGT ATTG

Locus: Os03g0826600

Loading...

Locus: Os03g0826600

Loading...