Os03t0826600-02

Locus

Os03g0826600

Description

Non-specific phospholipase C1, Modulation of silicon distribution, Mechanical strength, Seed shattering

RAP-DB Gene Symbol Synonym(s)

NPC1, OsNPC1

RAP-DB Gene Name Synonym(s)

NON-SPECIFIC PHOSPHOLIPASE C1, Non-specific phospholipase C1

CGSNL Gene Symbol

NPC1

CGSNL Gene Name

NON-SPECIFIC PHOSPHOLIPASE C1

Oryzabase Gene Symbol Synonym(s)

OsNPC1

Oryzabase Gene Name Synonym(s)

Non-specific phospholipase C1

Transcript Evidence

AK099803

Protein Evidence

Q0DM59

Literature

PMID: 26991499

Note

Manual Curation

July 1, 2016

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, acting on ester bonds (GO:0016788)

Functional domain (InterPro)

Phosphoesterase (IPR007312)

Alkaline-phosphatase-like, core domain (IPR017850)

Full-length cDNA

J013098B07 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0826600-02)

Others

Oryzabase (21048)

Transcript

1702 bp

>Os03t0826600-02 Non-specific phospholipase C1, Modulation of silicon distribution, Mechanical strength, Seed shattering
AAGCAAAGCAAACCACTCGCCGAACACCAACTCCTCGCCGCCGCCGCCGAGGAGGAGGAG
GAGGGAGCGAGCTTGAcgccgtgccggcccccatgtccggcttcgcccagaacgcccgcg
ggatgggcctcggcatgccgcagaacgtcatgagcgggttcaagccggagtccgtgccgg
tctacgccgccctcgccgacgagttcgccgtgttcgaccggtggttcgcctccgtgccca
ccTCCACCCAGCCCAATCGCCTCTACGTCCATTCCGCGACCTCCCATGGCCTCACCTTCA
ATGCCCGCAAGGACCTCATCCATGGCTTCCCGCAGAAGACCATCTTCGATAGCCTCGAGG
AGAACGGCTTGTCCTTTGGCATCTACTACCAGAACATCCCGGCCACGCTCTTCTACCAGA
GCCTCCGCCGCCTCAAGCACCTCGTCAAGTTCCACCAGTACAGCCTCAAGTTCAAGCTTC
ACGCCAAGTGGGGAAAGCTGCCGAATTACGCGGTGATTGAGCAGAGGTACTTCGATTGCG
AGATGTTCCCTGCAAACGATGACCACCCCTCGCACGACGTAGCGAGGGGGCAGAGGTTCG
TCAAGGAGGTGTATGAGACGCTGCGAGCGAGTCCGCAGTGGAACGAGACTGCTCTGATCA
TCACCTATGATGAGCATGGTGGATTCTATGACCATGTGCCTACGCCGGTTGTCGGGGTTC
CACAGCCTGATGGAATTGTTGGCCCTGATCCTTACTACTTCAAGTTTGATCGGCTTGGAG
TGCGCGTGCCTTCTTTCCTTATCTCACCATGGATCGAGAAGCGCACTGTGATCCATGAAC
CAAATGGGCCGCAGGACTCCTCACAATATGAGCACTCATCCATCCCTGCAACAGTAAAGA
AGCTATTTAATTTACATTCTAACTTCCTGACAAAGAGGGATGCATGGGCTGGGACCTTTG
AGAACTACTTCAAAATCCGGAAAACACCCAGAACTGATTGTCCAGAGAAACTCCCAGAGG
TCACAAAGTCTCTGCAACCGTTTGGCCCTAAGGAAGATTCATCTCTGTCAGAGTTTCAAG
TGGAGTTGATTCAGCTTGCTTCTCAGCTCAATGGTGACCATGTACTCAACACCTACCCAG
ATATTGGCAGGACTATGACTGTGGGTGAAGCAAACCGCTATGCAGAGGATGCTGTTGCTA
GATTTTTGGAAGCTGGCAGGATTGCTCTAAGAGCTGGTGCAAATGAATCTGCTTTGGTCA
CCATGAGGCCTGCACTCACCAGCAGAGCCTCACCGTCCTCTGATTTATCATCTGAACTCT
GATGGATTGTTCTCAGATTTATCCACAATTCTGCATCATGATTTGCACCGCGTCAGCTTT
TGGTTGATGAGAACTCGTACAATGTGCTAAGAAAACATAGGTAGGTTGGTGTACGGCAAA
GTGTGCTAGTATTATGTAATTGATAGATCTTAAACATGGCTTTGTACATAGACATCATGA
TACTTGATATCTCAAGCTTTTACTTCAGCTGTCCTCTGATAACGCTGAGATATCAGCTCA
GAAGTATCTGATAAGATCCTACTCTGGATAAGCTGGAGAGGGAATTTGTAAACCATCGAT
ATTCAGCTCTGTACCTGCTTATTCAGCAGTTGAACTGCACTTCTGATGAAATACTTTATG
TACACCAGTTATAGTGGTATTG

CDS

1230 bp

>Os03t0826600-02 Non-specific phospholipase C1, Modulation of silicon distribution, Mechanical strength, Seed shattering
atgtccggcttcgcccagaacgcccgcgggatgggcctcggcatgccgcagaacgtcatg
agcgggttcaagccggagtccgtgccggtctacgccgccctcgccgacgagttcgccgtg
ttcgaccggtggttcgcctccgtgcccaccTCCACCCAGCCCAATCGCCTCTACGTCCAT
TCCGCGACCTCCCATGGCCTCACCTTCAATGCCCGCAAGGACCTCATCCATGGCTTCCCG
CAGAAGACCATCTTCGATAGCCTCGAGGAGAACGGCTTGTCCTTTGGCATCTACTACCAG
AACATCCCGGCCACGCTCTTCTACCAGAGCCTCCGCCGCCTCAAGCACCTCGTCAAGTTC
CACCAGTACAGCCTCAAGTTCAAGCTTCACGCCAAGTGGGGAAAGCTGCCGAATTACGCG
GTGATTGAGCAGAGGTACTTCGATTGCGAGATGTTCCCTGCAAACGATGACCACCCCTCG
CACGACGTAGCGAGGGGGCAGAGGTTCGTCAAGGAGGTGTATGAGACGCTGCGAGCGAGT
CCGCAGTGGAACGAGACTGCTCTGATCATCACCTATGATGAGCATGGTGGATTCTATGAC
CATGTGCCTACGCCGGTTGTCGGGGTTCCACAGCCTGATGGAATTGTTGGCCCTGATCCT
TACTACTTCAAGTTTGATCGGCTTGGAGTGCGCGTGCCTTCTTTCCTTATCTCACCATGG
ATCGAGAAGCGCACTGTGATCCATGAACCAAATGGGCCGCAGGACTCCTCACAATATGAG
CACTCATCCATCCCTGCAACAGTAAAGAAGCTATTTAATTTACATTCTAACTTCCTGACA
AAGAGGGATGCATGGGCTGGGACCTTTGAGAACTACTTCAAAATCCGGAAAACACCCAGA
ACTGATTGTCCAGAGAAACTCCCAGAGGTCACAAAGTCTCTGCAACCGTTTGGCCCTAAG
GAAGATTCATCTCTGTCAGAGTTTCAAGTGGAGTTGATTCAGCTTGCTTCTCAGCTCAAT
GGTGACCATGTACTCAACACCTACCCAGATATTGGCAGGACTATGACTGTGGGTGAAGCA
AACCGCTATGCAGAGGATGCTGTTGCTAGATTTTTGGAAGCTGGCAGGATTGCTCTAAGA
GCTGGTGCAAATGAATCTGCTTTGGTCACCATGAGGCCTGCACTCACCAGCAGAGCCTCA
CCGTCCTCTGATTTATCATCTGAACTCTGA

Protein

410 aa

>Os03t0826600-02 Non-specific phospholipase C1, Modulation of silicon distribution, Mechanical strength, Seed shattering
MSGFAQNARGMGLGMPQNVMSGFKPESVPVYAALADEFAVFDRWFASVPTSTQPNRLYVH
SATSHGLTFNARKDLIHGFPQKTIFDSLEENGLSFGIYYQNIPATLFYQSLRRLKHLVKF
HQYSLKFKLHAKWGKLPNYAVIEQRYFDCEMFPANDDHPSHDVARGQRFVKEVYETLRAS
PQWNETALIITYDEHGGFYDHVPTPVVGVPQPDGIVGPDPYYFKFDRLGVRVPSFLISPW
IEKRTVIHEPNGPQDSSQYEHSSIPATVKKLFNLHSNFLTKRDAWAGTFENYFKIRKTPR
TDCPEKLPEVTKSLQPFGPKEDSSLSEFQVELIQLASQLNGDHVLNTYPDIGRTMTVGEA
NRYAEDAVARFLEAGRIALRAGANESALVTMRPALTSRASPSSDLSSEL*

5'UTR

chr03:34724353..34724428 (+ strand) : 76 bp

chr03:34724831..34724846 (+ strand) : 16 bp

CDS

chr03:34724847..34725582 (+ strand) : 736 bp

chr03:34726124..34726300 (+ strand) : 177 bp

chr03:34726545..34726861 (+ strand) : 317 bp

3'UTR

chr03:34726862..34727241 (+ strand) : 380 bp

FASTA

>Os03t0826600-02 class=Sequence position=chr03:34724353..34727241 (+ strand)
AAGCAAAGCA AACCACTCGC CGAACACCAA CTCCTCGCCG CCGCCGCCGA GGAGGAGGAG GAGGGAGCGA GCTTGACGCC
GGCGCCATGG CGGGCGGGGG AGGTAGGGAG CGGCGCGGCG GGGGGAGGCT GCTCGTCGGG GTGCTGCTCC TGACGCTGGT
GGTGTCCGGG CACTGCCTGG AGAGCACGCA CCACCGCGGG CTGAAGCGGC GGCGGCGgaa gcacgagatc cactcgccga
tcaagacggt ggtggtggtg gtgatggaga atcggagctt cgaccacatc ctcgggtggc tcagccgcac ccgccccgac
ATCGACGGGC TCAACGGCAC GCAATCCAAC CGCCTCAACG CCTCCGACCC TTCCTCCCCG GAGATCTTCG TCACCGACGA
GGCcggctac gtcgactccg accccggcca cggcttcgag gacatccgcg agcagatctt cggctccgcc gacacctccg
ccgtgccggc ccccatgtcc ggcttcgccc agaacgcccg cgggatgggc ctcggcatgc cgcagaacgt catgagcggg
ttcaagccgg agtccgtgcc ggtctacgcc gccctcgccg acgagttcgc cgtgttcgac cggtggttcg cctccgtgcc
caccTCCACC CAGCCCAATC GCCTCTACGT CCATTCCGCG ACCTCCCATG GCCTCACCTT CAATGCCCGC AAGGACCTCA
TCCATGGCTT CCCGCAGAAG ACCATCTTCG ATAGCCTCGA GGAGAACGGC TTGTCCTTTG GCATCTACTA CCAGAACATC
CCGGCCACGC TCTTCTACCA GAGCCTCCGC CGCCTCAAGC ACCTCGTCAA GTTCCACCAG TACAGCCTCA AGTTCAAGCT
TCACGCCAAG TGGGGAAAGC TGCCGAATTA CGCGGTGATT GAGCAGAGGT ACTTCGATTG CGAGATGTTC CCTGCAAACG
ATGACCACCC CTCGCACGAC GTAGCGAGGG GGCAGAGGTT CGTCAAGGAG GTGTATGAGA CGCTGCGAGC GAGTCCGCAG
TGGAACGAGA CTGCTCTGAT CATCACCTAT GATGAGCATG GTGGATTCTA TGACCATGTG CCTACGCCGG TTGTCGGGGT
TCCACAGCCT GATGGAATTG TTGGCCCTGA TCCTTACTAC TTCAAGTTTG ATCGGCTTGG AGTGCGCGTG CCTTCTTTCC
TTATCTCACC ATGGATCGAG AAGCGCACTG GTAAGTACTT GTGCTGTTTG CATCTATTCC CTTTCAAGAA GTTATTCCTT
GAATTTTGAT GTCTATAAGT AAAGACTATT GATTAGCGAA CTTGTTAAGA TTAGTCTCTG TTAGTATGAA TTTTACTGCA
ATATTCGAGG GAGAATTTGT CATTCATTCT CCACAGAAAC ATTCATCGAG TAACATAGGT GTGTAGGCTA GGTAATATAG
ACCGAGCCTT TGAGTTTCCA TAGTAGATAA CATTTCAAAA AGTTGCATAT GAATAAAAAA GTGCAAGACA TTTTTAGCTA
ACTTGTTCTA TGTAGCAAAC ATGAGTTCTA TGTTTGCTCT TTGCTTGTAA AGTTGTACTT GACAAACCAA GGAACTTGAA
CGTTGAACCA CTGTAAGGCA CAACTGTACA AGCAAAGAGC CAACTAGCAT GTATCATGCT GTTTTATGTT GGAAGGGCCA
GTTGTGCCTT ACACAACCAT AGAAATATTT TAATGGTGTT CTGTTTTGTA TATCTCTTAG TATTAACTGG TCTTGCTTTT
CATTTCTGCA GTGATCCATG AACCAAATGG GCCGCAGGAC TCCTCACAAT ATGAGCACTC ATCCATCCCT GCAACAGTAA
AGAAGCTATT TAATTTACAT TCTAACTTCC TGACAAAGAG GGATGCATGG GCTGGGACCT TTGAGAACTA CTTCAAAATC
CGGAAAACAC CCAGAACTGA TTGTCCAGGT ATATAGTTTT GTGTTCATTA TGTTATTATT AGAAGATATA TGTACTCTAC
TACACCAATG CCATTTTGTT GACGCTGACA ATTATTTAGG GAAAGTATCA CAAAGTTCAG ATATTGTAGA GCATTCTGTT
CTGGAAGCTC CCAATGCTTA CAGTTGCTTA TCAATGCAGA GTTTTGGAAC TTAGTTAATT ATTACTGAAA TTGCATTGCA
ACCTAATTAT ATATGTTATT GTTTCCTAAC AGAGAAACTC CCAGAGGTCA CAAAGTCTCT GCAACCGTTT GGCCCTAAGG
AAGATTCATC TCTGTCAGAG TTTCAAGTGG AGTTGATTCA GCTTGCTTCT CAGCTCAATG GTGACCATGT ACTCAACACC
TACCCAGATA TTGGCAGGAC TATGACTGTG GGTGAAGCAA ACCGCTATGC AGAGGATGCT GTTGCTAGAT TTTTGGAAGC
TGGCAGGATT GCTCTAAGAG CTGGTGCAAA TGAATCTGCT TTGGTCACCA TGAGGCCTGC ACTCACCAGC AGAGCCTCAC
CGTCCTCTGA TTTATCATCT GAACTCTGAT GGATTGTTCT CAGATTTATC CACAATTCTG CATCATGATT TGCACCGCGT
CAGCTTTTGG TTGATGAGAA CTCGTACAAT GTGCTAAGAA AACATAGGTA GGTTGGTGTA CGGCAAAGTG TGCTAGTATT
ATGTAATTGA TAGATCTTAA ACATGGCTTT GTACATAGAC ATCATGATAC TTGATATCTC AAGCTTTTAC TTCAGCTGTC
CTCTGATAAC GCTGAGATAT CAGCTCAGAA GTATCTGATA AGATCCTACT CTGGATAAGC TGGAGAGGGA ATTTGTAAAC
CATCGATATT CAGCTCTGTA CCTGCTTATT CAGCAGTTGA ACTGCACTTC TGATGAAATA CTTTATGTAC ACCAGTTATA
GTGGTATTG

Locus: Os03g0826600

Loading...

Locus: Os03g0826600

Loading...