Os03t0829900-01

Locus

Os03g0829900

Description

Homolog of tomato fruit-weight 2.2, "fruit-weight 2.2-like" gene family member, Regulation of tiller number and plant yield, Translocation of cadmium from roots to shoots

RAP-DB Gene Symbol Synonym(s)

OsFWL4

RAP-DB Gene Name Synonym(s)

FW2.2-like 4, fruit-weight 2.2-like 4

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFWL4, FWL4

Oryzabase Gene Name Synonym(s)

FW2.2-like 4, fruit-weight 2.2-like 4

Transcript Evidence

HM008661 (maize)

Protein Evidence

Q850Y3

Literature

PMID: 31991936

PMID: 29453663

Note

Manual Curation

January 30, 2020

Functional domain (InterPro)

PLAC8 motif-containing protein (IPR006461)

Expression Databases

TENOR (Os03t0829900-00)

Others

Oryzabase (13473)

Transcript

509 bp

>Os03t0829900-01 Homolog of tomato fruit-weight 2.2, "fruit-weight 2.2-like" gene family member, Regulation of tiller number and plant yield, Translocation of cadmium from roots to shoots
GCTAAGCTCATGCTCATCGCTCCTAGCTAGCAAGCCTGCCGATCACAACAGCAGCAGCTG
GTCAGTGGTCGCACTAGCGAAGGAGAGGATCGGAGGAGATGGCGAGGCCGCAACACAATG
ACTGGTCATCCGGACTCTTCGCCTGCTTCAATGACTGCGAAGTTTGTTGCTTGACGACGG
TGTGCCCGTGCATCACGTTCGGGCGGAGCGCGGAGATCGTGTCGAGGGGGGAGAGGACGT
GCTGCGCGGCGGGCGTGATGTGCGTGCTGCTCGGCTTCTTCGCCCACTGCCACTGCCTCT
ACTCCTGCTGCTACCGCGGCAAGATGCGCGACAGCTTCCACCTCCCCGAGGACCCATGCT
GCGACTGCTGCGTCCACGCCCTCTGCCTGCAGTGCGCGCTGTGCCAGGAGTACAGGCACC
TCAAGAGCCTCGGCTACAAACCCTCGCTTGGCTGGCTCGGAAACAACCAGCACGTCCCGC
CCAAGCACAACCCGCCGATGCGACGCTAA

CDS

411 bp

>Os03t0829900-01 Homolog of tomato fruit-weight 2.2, "fruit-weight 2.2-like" gene family member, Regulation of tiller number and plant yield, Translocation of cadmium from roots to shoots
ATGGCGAGGCCGCAACACAATGACTGGTCATCCGGACTCTTCGCCTGCTTCAATGACTGC
GAAGTTTGTTGCTTGACGACGGTGTGCCCGTGCATCACGTTCGGGCGGAGCGCGGAGATC
GTGTCGAGGGGGGAGAGGACGTGCTGCGCGGCGGGCGTGATGTGCGTGCTGCTCGGCTTC
TTCGCCCACTGCCACTGCCTCTACTCCTGCTGCTACCGCGGCAAGATGCGCGACAGCTTC
CACCTCCCCGAGGACCCATGCTGCGACTGCTGCGTCCACGCCCTCTGCCTGCAGTGCGCG
CTGTGCCAGGAGTACAGGCACCTCAAGAGCCTCGGCTACAAACCCTCGCTTGGCTGGCTC
GGAAACAACCAGCACGTCCCGCCCAAGCACAACCCGCCGATGCGACGCTAA

Protein

137 aa

>Os03t0829900-01 Homolog of tomato fruit-weight 2.2, "fruit-weight 2.2-like" gene family member, Regulation of tiller number and plant yield, Translocation of cadmium from roots to shoots
MARPQHNDWSSGLFACFNDCEVCCLTTVCPCITFGRSAEIVSRGERTCCAAGVMCVLLGF
FAHCHCLYSCCYRGKMRDSFHLPEDPCCDCCVHALCLQCALCQEYRHLKSLGYKPSLGWL
GNNQHVPPKHNPPMRR*

5'UTR

chr03:34861423..34861520 (- strand) : 98 bp

CDS

chr03:34861356..34861422 (- strand) : 67 bp

chr03:34860760..34861103 (- strand) : 344 bp

FASTA

>Os03t0829900-01 class=Sequence position=chr03:34860760..34861520 (- strand)
GCTAAGCTCA TGCTCATCGC TCCTAGCTAG CAAGCCTGCC GATCACAACA GCAGCAGCTG GTCAGTGGTC GCACTAGCGA
AGGAGAGGAT CGGAGGAGAT GGCGAGGCCG CAACACAATG ACTGGTCATC CGGACTCTTC GCCTGCTTCA ATGACTGCGA
AGTTTGTGCG TATATATTAC TTCCATATTG TCGATCAGTA CTATACTACT TGCGATGATT CTATCGATCG TCCTTCACCA
GATTATATAT ATTGCATTTA TTGTATAGAC CATCTATTAA TTCTAAGCTA ATTTAAGCTT ATTTCCCGGA ATATATATAT
TGATTGAGTA ATTTTACCAT ATAACATTTG GTACCATATT AGATCATTCC TTAATATTCA CGTCTTTATG TGACACAAAC
TAATTATATA TATGCAGGTT GCTTGACGAC GGTGTGCCCG TGCATCACGT TCGGGCGGAG CGCGGAGATC GTGTCGAGGG
GGGAGAGGAC GTGCTGCGCG GCGGGCGTGA TGTGCGTGCT GCTCGGCTTC TTCGCCCACT GCCACTGCCT CTACTCCTGC
TGCTACCGCG GCAAGATGCG CGACAGCTTC CACCTCCCCG AGGACCCATG CTGCGACTGC TGCGTCCACG CCCTCTGCCT
GCAGTGCGCG CTGTGCCAGG AGTACAGGCA CCTCAAGAGC CTCGGCTACA AACCCTCGCT TGGCTGGCTC GGAAACAACC
AGCACGTCCC GCCCAAGCAC AACCCGCCGA TGCGACGCTA A

Locus: Os03g0829900

Loading...

Locus: Os03g0829900

Loading...