Os03t0830200-00

Locus

Os03g0830200

Description

Protein of unknown function Cys-rich family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFWL6, FWL6

Oryzabase Gene Name Synonym(s)

FW2.2-like 6, fruit-weight 2.2-like 6

Transcript Evidence

ab initio prediction

Protein Evidence

NP_001151128.1 (RefSeq)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Uncharacterised protein family Cys-rich (IPR006461)

Expression Databases

TENOR (Os03t0830200-00)

Others

Oryzabase (13475)

Transcript

453 bp

>Os03t0830200-00 Protein of unknown function Cys-rich family protein.
ATGGCCAAGCCAAGCGCCGCTCCGGTGACCGGCGTCCCCGTCGGCTCCGCCGCCTGGTCC
ACCGGCCTCTGCGACTGCTTCGACGACTGCGGCCTATGCTGCTTGACGTGCTGGTGCCCG
TGCATCACGTTCGGGAGGGTGGCGGAGATGGTGGACAGGGGCTCGACGTCGTGCGGCACC
GGCGGCGCGCTGTACGGGCTGCTGTGCGCGTTCACCGGGTGCCAGTGGATCTACTCCTGC
ACCTACCGGGGCAAGATGCGCACTCAGTACGGGCTCGCCGAAGCCGGCTGCGCCGACTGC
TGCGTCCACTTCTGCTGCGAGCCATGCGCGCTGTGCCAGGAGTACCGCGAGCTCGTCGCC
CGCGGCTACGACCCCAAGCTCGGCTGGCACCTCAACGCCGACCGCGCCGCCGCCGCCGGC
GCCGCTCCCGCCGTGCAGTACATGGGCCGCTAA

CDS

453 bp

>Os03t0830200-00 Protein of unknown function Cys-rich family protein.
ATGGCCAAGCCAAGCGCCGCTCCGGTGACCGGCGTCCCCGTCGGCTCCGCCGCCTGGTCC
ACCGGCCTCTGCGACTGCTTCGACGACTGCGGCCTATGCTGCTTGACGTGCTGGTGCCCG
TGCATCACGTTCGGGAGGGTGGCGGAGATGGTGGACAGGGGCTCGACGTCGTGCGGCACC
GGCGGCGCGCTGTACGGGCTGCTGTGCGCGTTCACCGGGTGCCAGTGGATCTACTCCTGC
ACCTACCGGGGCAAGATGCGCACTCAGTACGGGCTCGCCGAAGCCGGCTGCGCCGACTGC
TGCGTCCACTTCTGCTGCGAGCCATGCGCGCTGTGCCAGGAGTACCGCGAGCTCGTCGCC
CGCGGCTACGACCCCAAGCTCGGCTGGCACCTCAACGCCGACCGCGCCGCCGCCGCCGGC
GCCGCTCCCGCCGTGCAGTACATGGGCCGCTAA

Protein

151 aa

>Os03t0830200-00 Protein of unknown function Cys-rich family protein.
MAKPSAAPVTGVPVGSAAWSTGLCDCFDDCGLCCLTCWCPCITFGRVAEMVDRGSTSCGT
GGALYGLLCAFTGCQWIYSCTYRGKMRTQYGLAEAGCADCCVHFCCEPCALCQEYRELVA
RGYDPKLGWHLNADRAAAAGAAPAVQYMGR*

CDS

chr03:34871258..34871354 (- strand) : 97 bp

chr03:34870676..34871031 (- strand) : 356 bp

FASTA

>Os03t0830200-00 class=Sequence position=chr03:34870676..34871354 (- strand)
ATGGCCAAGC CAAGCGCCGC TCCGGTGACC GGCGTCCCCG TCGGCTCCGC CGCCTGGTCC ACCGGCCTCT GCGACTGCTT
CGACGACTGC GGCCTATGTA CGTTCTCGCT CTTTTTTATA AGCTTCAGCT CTTTATTTTG CTTTTTCTCC CTTCTTCTGA
CATAAGTTGG TCTGGCTGAT TCCATTGTGG TATATTGATA TGTAATCATT TTACGTGTTC ACGAAAAAAA CGTTCTCGCT
CTCGCCGCCG GCCACCGTGC CATGGCTAGA TCATATCATG AACATGATCT GTAATTTACT AATTAATTCA CATTAATCTG
CAGGCTGCTT GACGTGCTGG TGCCCGTGCA TCACGTTCGG GAGGGTGGCG GAGATGGTGG ACAGGGGCTC GACGTCGTGC
GGCACCGGCG GCGCGCTGTA CGGGCTGCTG TGCGCGTTCA CCGGGTGCCA GTGGATCTAC TCCTGCACCT ACCGGGGCAA
GATGCGCACT CAGTACGGGC TCGCCGAAGC CGGCTGCGCC GACTGCTGCG TCCACTTCTG CTGCGAGCCA TGCGCGCTGT
GCCAGGAGTA CCGCGAGCTC GTCGCCCGCG GCTACGACCC CAAGCTCGGC TGGCACCTCA ACGCCGACCG CGCCGCCGCC
GCCGGCGCCG CTCCCGCCGT GCAGTACATG GGCCGCTAA

Locus: Os03g0830200

Loading...

Locus: Os03g0830200

Loading...