Os03t0830300-00

Locus

Os03g0830300

Description

Similar to PGPS/D12.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFWL8, FWL8

Oryzabase Gene Name Synonym(s)

FW2.2-like 8, fruit-weight 2.2-like 8

Transcript Evidence

AK373762 (DDBJ)

Protein Evidence

NP_001151128.1 (RefSeq)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Uncharacterised protein family Cys-rich (IPR006461)

Expression Databases

TENOR (Os03t0830300-00)

Others

Oryzabase (13477)

Transcript

505 bp

>Os03t0830300-00 Similar to PGPS/D12.
GGAGATGGCCAAGCCAAGCGCCGGTGCGGTGACCGGCGTCCCCATCGGCTCCGCCGCCTG
GTCCACCGGCCTCTGCGACTGCTTCGACGACTGTGGCCTATGCTGCACGACGTGCTGGTG
CCCGTGCATCACGTTCGGGAGGGTGGCGGAGATCGTGGACAGGGGGTCGACGTCGTTCGG
CACCGGCGGCGCGCTCTACGCGCTGCTGTGCGCGTTCACCGGGTTCCAGTGGATGTACCT
GCACCTACCGCGGCAAGATGCGCGCCCAGCACGGCCTCGGCGACGCCGCCTGCGGCGACT
GCTGCGTCCACTGCTGCTGCGAGTCCTGCGCGCTGTGCCAGGAGTACCGCGAGCTCGTCG
CCCGCGGCTACGACCCCAAGCTCGGATGGCACCTCAACGTCGAGCGCGGCGCCGCTGCCG
CCGCCGCCGCCGCCGCGGCACCGGCCGTGCAGCACATGGGCCGTTAGAAAAAGCTTCACT
TCATGCACTctccatcccaaaataa

CDS

501 bp

>Os03t0830300-00 Similar to PGPS/D12.
ATGGCCAAGCCAAGCGCCGGTGCGGTGACCGGCGTCCCCATCGGCTCCGCCGCCTGGTCC
ACCGGCCTCTGCGACTGCTTCGACGACTGTGGCCTATGCTGCACGACGTGCTGGTGCCCG
TGCATCACGTTCGGGAGGGTGGCGGAGATCGTGGACAGGGGGTCGACGTCGTTCGGCACC
GGCGGCGCGCTCTACGCGCTGCTGTGCGCGTTCACCGGGTTCCAGTGGATGTACCTGCAC
CTACCGCGGCAAGATGCGCGCCCAGCACGGCCTCGGCGACGCCGCCTGCGGCGACTGCTG
CGTCCACTGCTGCTGCGAGTCCTGCGCGCTGTGCCAGGAGTACCGCGAGCTCGTCGCCCG
CGGCTACGACCCCAAGCTCGGATGGCACCTCAACGTCGAGCGCGGCGCCGCTGCCGCCGC
CGCCGCCGCCGCGGCACCGGCCGTGCAGCACATGGGCCGTTAGAAAAAGCTTCACTTCAT
GCACTctccatcccaaaataa

Protein

167 aa

>Os03t0830300-00 Similar to PGPS/D12.
MAKPSAGAVTGVPIGSAAWSTGLCDCFDDCGLCCTTCWCPCITFGRVAEIVDRGSTSFGT
GGALYALLCAFTGFQWMYLHLPRQDARPARPRRRRLRRLLRPLLLRVLRAVPGVPRARRP
RLRPQARMAPQRRARRRCRRRRRRGTGRAAHGPLEKASLHALSIPK*

5'UTR

chr03:34874541..34874544 (- strand) : 4 bp

CDS

chr03:34874444..34874540 (- strand) : 97 bp

chr03:34873910..34874313 (- strand) : 404 bp

FASTA

>Os03t0830300-00 class=Sequence position=chr03:34873910..34874544 (- strand)
GGAGATGGCC AAGCCAAGCG CCGGTGCGGT GACCGGCGTC CCCATCGGCT CCGCCGCCTG GTCCACCGGC CTCTGCGACT
GCTTCGACGA CTGTGGCCTA TGTACGTACA TCTACGTCCT CGCCACCGGC CATGGCTAGC TACTAGTAGC TTGCATCCAT
GGTGATCGAT CGATCGATCA ACATGAACTG ATTCATTCAA TCTGTAATAA CAATCTGTGC AATATTGATA GGCTGCACGA
CGTGCTGGTG CCCGTGCATC ACGTTCGGGA GGGTGGCGGA GATCGTGGAC AGGGGGTCGA CGTCGTTCGG CACCGGCGGC
GCGCTCTACG CGCTGCTGTG CGCGTTCACC GGGTTCCAGT GGATGTACCT GCACCTACCG CGGCAAGATG CGCGCCCAGC
ACGGCCTCGG CGACGCCGCC TGCGGCGACT GCTGCGTCCA CTGCTGCTGC GAGTCCTGCG CGCTGTGCCA GGAGTACCGC
GAGCTCGTCG CCCGCGGCTA CGACCCCAAG CTCGGATGGC ACCTCAACGT CGAGCGCGGC GCCGCTGCCG CCGCCGCCGC
CGCCGCGGCA CCGGCCGTGC AGCACATGGG CCGTTAGAAA AAGCTTCACT TCATGCACTc tccatcccaa aataa

Locus: Os03g0830300

Loading...

Locus: Os03g0830300

Loading...