Os03t0830500-01

Locus

Os03g0830500

Description

Similar to PGPS/D12.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFWL7, FWL7

Oryzabase Gene Name Synonym(s)

FW2.2-like 7, fruit-weight 2.2-like 7

Transcript Evidence

AK071173 (DDBJ, Best hit)

Protein Evidence

D9HP26 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Uncharacterised protein family Cys-rich (IPR006461)

Full-length cDNA

J023082F07 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0830500-01)

RiceXPro (AK071173)

Others

Oryzabase (13476)

KEGG (Os03t0830500-01)

Transcript

825 bp

>Os03t0830500-01 Similar to PGPS/D12.
ATTCCCACCACAAGCTAATTAAGGTACCAGCAACTCCATCACATCCTTAATTTGCAGCAG
CAGGTAATTGTACACCGGCGAAGGAAATTAAAGGAAAGTAGGAGATCGATGGCCAAGCCA
AGCGCCGCCGCCTggtccaccggcctcttggactgcttcgacgactgcggcctatGCTGC
ATGACGTGCTGGTGCCCGTGCATCACGTTCGGGCGGGTGGCGGAGATGGTGGACAGGGGG
TCGACGTCGTGCGGCACCAGCGGCGCGCTGTACGCGCTGCTGGCGACGGTCACCGGCTGC
CAGTTCGTCTACTCCTGCGTCTACCGGGGCAAGATGCGCGCCCAGTACGGCCTCGGCGAC
GACGCCGCCTGCGCCGACTGCTGCGTCCACTTCTGGTGCAACAAGTGCGCGCTGTGCCAG
GAGTACCGCGAGCTCGTCGCCCGCGGCTACGACCCCAAGCTCGGATGGGACCTCAACGTC
CAGCGCGGCGCCGCCGCCGCCGCAGCGCCCGCCGTGCAGCACATGGGCCGTTAAATGGAT
TAGCTAGCTATAGCGTCACCTCGTATCTATCATATCATCGATCGATCGTACTTTGGGCGT
GTGAAGTGGTGTCCAGTTAAAAAAAAGTTTTTTTTTTGGGAGCTAGTTATAGTATCCAGT
TTTTTAAAAGAAATTTATAAGTGGTATATTAATTATATGCGTTTTTTTACTTGATACTAT
CTACTATGCCTCTATATACTCCTGTAATTAAGTTTGTGTAAGTATGGTGACGCATGGTCA
GGTTTTGTTTGTAATTCTCTGCACTTAATCAATTGTTTGTTGTAT

CDS

426 bp

>Os03t0830500-01 Similar to PGPS/D12.
ATGGCCAAGCCAAGCGCCGCCGCCTggtccaccggcctcttggactgcttcgacgactgc
ggcctatGCTGCATGACGTGCTGGTGCCCGTGCATCACGTTCGGGCGGGTGGCGGAGATG
GTGGACAGGGGGTCGACGTCGTGCGGCACCAGCGGCGCGCTGTACGCGCTGCTGGCGACG
GTCACCGGCTGCCAGTTCGTCTACTCCTGCGTCTACCGGGGCAAGATGCGCGCCCAGTAC
GGCCTCGGCGACGACGCCGCCTGCGCCGACTGCTGCGTCCACTTCTGGTGCAACAAGTGC
GCGCTGTGCCAGGAGTACCGCGAGCTCGTCGCCCGCGGCTACGACCCCAAGCTCGGATGG
GACCTCAACGTCCAGCGCGGCGCCGCCGCCGCCGCAGCGCCCGCCGTGCAGCACATGGGC
CGTTAA

Protein

142 aa

>Os03t0830500-01 Similar to PGPS/D12.
MAKPSAAAWSTGLLDCFDDCGLCCMTCWCPCITFGRVAEMVDRGSTSCGTSGALYALLAT
VTGCQFVYSCVYRGKMRAQYGLGDDAACADCCVHFWCNKCALCQEYRELVARGYDPKLGW
DLNVQRGAAAAAAPAVQHMGR*

5'UTR

chr03:34884471..34884578 (- strand) : 108 bp

CDS

chr03:34884404..34884470 (- strand) : 67 bp

chr03:34883811..34884169 (- strand) : 359 bp

3'UTR

chr03:34883520..34883810 (- strand) : 291 bp

FASTA

>Os03t0830500-01 class=Sequence position=chr03:34883520..34884578 (- strand)
ATTCCCACCA CAAGCTAATT AAGGTACCAG CAACTCCATC ACATCCTTAA TTTGCAGCAG CAGGTAATTG TACACCGGCG
AAGGAAATTA AAGGAAAGTA GGAGATCGAT GGCCAAGCCA AGCGCCGCCG CCTggtccac cggcctcttg gactgcttcg
acgactgcgg cctatgtacg tcctcgtcct cgccgccggC CGCCGTGCCA TGGCTAGATC ATATGCAAAT CCTCCGTAGT
ACTACTAATG CAGTAGCCGT AGCTGACACG TGGGTTCGGA TCCCCACGTT AATGTCTACT ACTACATCAG CAGTAGTGCA
GATAATCTCT ACTGTGCTAG ATCATATCAT GAACACTGAT TCGTTAGTTC TGATCTGTAA CTAACTTATT AGTTCACATT
GATCTGCAGG CTGCATGACG TGCTGGTGCC CGTGCATCAC GTTCGGGCGG GTGGCGGAGA TGGTGGACAG GGGGTCGACG
TCGTGCGGCA CCAGCGGCGC GCTGTACGCG CTGCTGGCGA CGGTCACCGG CTGCCAGTTC GTCTACTCCT GCGTCTACCG
GGGCAAGATG CGCGCCCAGT ACGGCCTCGG CGACGACGCC GCCTGCGCCG ACTGCTGCGT CCACTTCTGG TGCAACAAGT
GCGCGCTGTG CCAGGAGTAC CGCGAGCTCG TCGCCCGCGG CTACGACCCC AAGCTCGGAT GGGACCTCAA CGTCCAGCGC
GGCGCCGCCG CCGCCGCAGC GCCCGCCGTG CAGCACATGG GCCGTTAAAT GGATTAGCTA GCTATAGCGT CACCTCGTAT
CTATCATATC ATCGATCGAT CGTACTTTGG GCGTGTGAAG TGGTGTCCAG TTAAAAAAAA GTTTTTTTTT TGGGAGCTAG
TTATAGTATC CAGTTTTTTA AAAGAAATTT ATAAGTGGTA TATTAATTAT ATGCGTTTTT TTACTTGATA CTATCTACTA
TGCCTCTATA TACTCCTGTA ATTAAGTTTG TGTAAGTATG GTGACGCATG GTCAGGTTTT GTTTGTAATT CTCTGCACTT
AATCAATTGT TTGTTGTAT

Locus: Os03g0830500

Loading...

Locus: Os03g0830500

Loading...