Os03t0837550-00

Locus

Os03g0837550

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjC40

Oryzabase Gene Name Synonym(s)

DnaJ domain protein C40

Transcript Evidence

Protein Evidence

Literature

Note

Manual Curation

Expression Databases

TENOR (Os03t0837550-00)

Others

Oryzabase (12197)

Transcript

831 bp

>Os03t0837550-00
ATGGCGACCGGTCGCAACGACGAAGAGGAAGCCGAGAAGGCTTACGAGCTCGCAGAGAAT
CGCTTCCGCGCCAACGACATCGCCGGAGCGCTCCACGCGGCCCGGGAGGCGCGGCGGCTG
TTCCCGCCACTCCCTGGCGTCGCCAGCGCCGTCGCCGCCTACGAGGTCCACCACGCCGCC
GCCTCCCGCGCAGACGCCGGCGACAAGTGGTACGCCATCCTCGCCGTCGGCGACGATTCA
TCCGCGACGACCTCGAGCGGCACTAATGGCGCCGCCGCCGTCATCACGCACGAAGACCTC
AAGCACCAGTACCACCGGCTCTGCCTCCTCCTGCACCCGGACAAGAACGCCGCCGCCGCC
GCCGAGGGCGCCTTCAAGCTGCTCCGGGAGGCGTGGGACAACCTCTCGCTTCTCCACCCG
CCGGGCTCCGCCGCGTCTCCTTCGGTAAGCTGTCCGCCACCGCCGCCGCCGCCGCCGCCA
GGGCCGCGTCGCATCTCCTGCCGGAAATGCCGCGGCTCGTTCTTCACGGTGGTCGGCGAC
GGCGTCTCCGGCGTGAACTGCGTCCACTGCAACCGCTGGGTGAGCTTGTTCCCGTGCCCC
GCTCGCTGTGCGAGGTGCGGCGTGAGGTTCACGGAGACTGTGTCCACCGGAACGCGTCTC
CTCCGGTGCGCCGCCTGCGAGAGGAGCTCCTACGTCTTCGTCAAGAACCCCTACTGCGCC
ACCTCCTGGATAACCGGATCTTCATATCGATTAAAATGTTGTCGAAGAAAACCATTTAGT
GCTCCGACTCCCATCACAAATTTTGACAATTTAACCCTTTATAAAATCTAA

CDS

831 bp

>Os03t0837550-00
ATGGCGACCGGTCGCAACGACGAAGAGGAAGCCGAGAAGGCTTACGAGCTCGCAGAGAAT
CGCTTCCGCGCCAACGACATCGCCGGAGCGCTCCACGCGGCCCGGGAGGCGCGGCGGCTG
TTCCCGCCACTCCCTGGCGTCGCCAGCGCCGTCGCCGCCTACGAGGTCCACCACGCCGCC
GCCTCCCGCGCAGACGCCGGCGACAAGTGGTACGCCATCCTCGCCGTCGGCGACGATTCA
TCCGCGACGACCTCGAGCGGCACTAATGGCGCCGCCGCCGTCATCACGCACGAAGACCTC
AAGCACCAGTACCACCGGCTCTGCCTCCTCCTGCACCCGGACAAGAACGCCGCCGCCGCC
GCCGAGGGCGCCTTCAAGCTGCTCCGGGAGGCGTGGGACAACCTCTCGCTTCTCCACCCG
CCGGGCTCCGCCGCGTCTCCTTCGGTAAGCTGTCCGCCACCGCCGCCGCCGCCGCCGCCA
GGGCCGCGTCGCATCTCCTGCCGGAAATGCCGCGGCTCGTTCTTCACGGTGGTCGGCGAC
GGCGTCTCCGGCGTGAACTGCGTCCACTGCAACCGCTGGGTGAGCTTGTTCCCGTGCCCC
GCTCGCTGTGCGAGGTGCGGCGTGAGGTTCACGGAGACTGTGTCCACCGGAACGCGTCTC
CTCCGGTGCGCCGCCTGCGAGAGGAGCTCCTACGTCTTCGTCAAGAACCCCTACTGCGCC
ACCTCCTGGATAACCGGATCTTCATATCGATTAAAATGTTGTCGAAGAAAACCATTTAGT
GCTCCGACTCCCATCACAAATTTTGACAATTTAACCCTTTATAAAATCTAA

Protein

277 aa

>Os03t0837550-00
MATGRNDEEEAEKAYELAENRFRANDIAGALHAAREARRLFPPLPGVASAVAAYEVHHAA
ASRADAGDKWYAILAVGDDSSATTSSGTNGAAAVITHEDLKHQYHRLCLLLHPDKNAAAA
AEGAFKLLREAWDNLSLLHPPGSAASPSVSCPPPPPPPPPGPRRISCRKCRGSFFTVVGD
GVSGVNCVHCNRWVSLFPCPARCARCGVRFTETVSTGTRLLRCAACERSSYVFVKNPYCA
TSWITGSSYRLKCCRRKPFSAPTPITNFDNLTLYKI*

CDS

chr03:35202558..35203388 (+ strand) : 831 bp

FASTA

>Os03t0837550-00 class=Sequence position=chr03:35202558..35203388 (+ strand)
ATGGCGACCG GTCGCAACGA CGAAGAGGAA GCCGAGAAGG CTTACGAGCT CGCAGAGAAT CGCTTCCGCG CCAACGACAT
CGCCGGAGCG CTCCACGCGG CCCGGGAGGC GCGGCGGCTG TTCCCGCCAC TCCCTGGCGT CGCCAGCGCC GTCGCCGCCT
ACGAGGTCCA CCACGCCGCC GCCTCCCGCG CAGACGCCGG CGACAAGTGG TACGCCATCC TCGCCGTCGG CGACGATTCA
TCCGCGACGA CCTCGAGCGG CACTAATGGC GCCGCCGCCG TCATCACGCA CGAAGACCTC AAGCACCAGT ACCACCGGCT
CTGCCTCCTC CTGCACCCGG ACAAGAACGC CGCCGCCGCC GCCGAGGGCG CCTTCAAGCT GCTCCGGGAG GCGTGGGACA
ACCTCTCGCT TCTCCACCCG CCGGGCTCCG CCGCGTCTCC TTCGGTAAGC TGTCCGCCAC CGCCGCCGCC GCCGCCGCCA
GGGCCGCGTC GCATCTCCTG CCGGAAATGC CGCGGCTCGT TCTTCACGGT GGTCGGCGAC GGCGTCTCCG GCGTGAACTG
CGTCCACTGC AACCGCTGGG TGAGCTTGTT CCCGTGCCCC GCTCGCTGTG CGAGGTGCGG CGTGAGGTTC ACGGAGACTG
TGTCCACCGG AACGCGTCTC CTCCGGTGCG CCGCCTGCGA GAGGAGCTCC TACGTCTTCG TCAAGAACCC CTACTGCGCC
ACCTCCTGGA TAACCGGATC TTCATATCGA TTAAAATGTT GTCGAAGAAA ACCATTTAGT GCTCCGACTC CCATCACAAA
TTTTGACAAT TTAACCCTTT ATAAAATCTA A

Locus: Os03g0837550

Loading...

Locus: Os03g0837550

Loading...