Os03t0840800-01

Locus

Os03g0840800

Description

Similar to Phospholipase D.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PLDdelta2

CGSNL Gene Name

PHOSPHOLIPASE D DELTA 2

Oryzabase Gene Symbol Synonym(s)

OsPLDdelta2, RPLD5, OsPLDnu1

Oryzabase Gene Name Synonym(s)

Phospholipase D delta 2, Phospholipase D nu 1

Transcript Evidence

AK069703 (DDBJ, Best hit)

Protein Evidence

B8AN68 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

C2 calcium-dependent membrane targeting (IPR000008)

C2 calcium/lipid-binding domain, CaLB (IPR008973)

Phospholipase D (IPR015679)

C2 membrane targeting protein (IPR018029)

Full-length cDNA

J023027C22 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0840800-01)

Others

Oryzabase (2955)

Transcript

2730 bp

>Os03t0840800-01 Similar to Phospholipase D.
CGTGCCCCCGCCCGCGCCGCCATCTCTCTCCTTCCTCCTGTATTGTTACGCAAGCCATCC
GAGCCAAGCAGGAGAAGAGGAAGAGGAAGAGGAAGAGGAAGAGCATGCCCCCCTGCGCGG
CATGGGGAAAAGCTCCGCCGACTTGTCCGCCTCCTCGGAGTCGGCCgtgctcctgcacgg
cgacctcgacatttggataaccgaggccaagtgcctccccaacatggacatcatgtcgga
gcggatgcgccgcttcttcaccggctacggcgcctgcggctcctcgtgcggcggcaccgg
cgacaacgcgcgccgggccggcggcggcgtcaggcccaagaagatcatcaccagcgaccc
ctacgtctccgtctgcctcgccggcgccaccgtcgcgcagacgcgggtcatccccaactc
cgagaaccccaggtgggaggagcgcttccgcgtcgaggtcgcccacgccgtctccaggct
cgagttccacgtcaaggacaacgacgtcttcggcgcgcagctcatcggcgtcgcctccct
ccccgtcgacaggatcctctccggcgcccccgccgagggctggttccccatcgacggcca
ctgcagcagcaaccccatgcggccgccgccggagctccgcctctccgtccagtacaggcc
catcgacgacaaccccctctacaggggcggcgccggcgccgtccccaacgcctacttccc
tctccgccgaggtggcggcgtcaccctctaccaggacgcccacgtcgccgacggcggcct
cccggccatccagatcgccggcggaagggcgtacgagcacggccgatgctgggaggacat
ctgccactccatcgtggaggcgcaccacctcgtgtacatggtcggatggtccatctacca
ccccgtcaagctcgtcagggaGCCCACCCGGGCGCTCCCCGGCGAGACGCCATCGACGCT
CGGCGAGCTTCTCAAGAAAAGGGCTCGCGAGGGCGTCCGCATCGTCATCTTGCTCTGGGA
CGACAAGACGTCGCATGACAAGTTCCTTCTCAAAACGGTTGAATGCAGGATGGTGTCATG
CATACACACGACGAGGAGACCAAAAAGTTTTTCAGGCATTCAGGTGTTCACTGTGTGCTG
GTTCCTCGCTATGCCAGCACTAAGCTTAGCATTTTCAAGCAGCAGgtagtgggaacttta
tttacacatcatcagaaatgtgtgcttgttgatacacaagctactgggaacaaccgcaaa
atcactgctttcattggtggtctagacttgtgcgacggcagatacgatacacctgaacat
aggcttttcaaagatcttgataccgctttcaacaaggacttccataatcctacatttcct
gttaattcatatggaccaagacagccatggcatgatttacactgcaagattgagggccct
gctgcctttgatatactgacaaactttgaacagcggtggagaaaagcaaccaaatggaag
gtcaatcttaagaaagttgcaagttggcatcatgacacgctgataaaaataaaccggatg
tcctggattgttaccccagctgcagatgaggctaatgcacatgtttgtgaagaaaaggac
ccagaaaattggcatgtgcaggtgttcaggtcaattgattcaggttctgtaaaggggttc
ccaaaaattgttcaggaggcagagtctcagaatcttgtctgtgcaaagaatctaaagatc
gacaaaagcatacacagtgcatatgtcaaagcaatcaggtctgcgcagcacttcatatac
attgagaaccagtatttcattgggtcatcgttcttatggtcctcacataaaagcgcaggt
gctgataacttaatacctgtggagctggccttgaagattgcaagcaagatcaaggcaaat
gagcagttcgcggtgtacattgtcctaccaatgtggcctgaaggcatcccaaccgcggca
ccgatgcagcaaatcctcttttggcagAGCCAAACAATGTCTATGATGTACAAGATCATA
GCGGACGCTCTGCAGATGCAGGGATTGGTTGAAGCTCACCCTCAAGATTATCTGAATTTC
TACTGCCTCGGCAAGCGCGAGGTCGCCGCCGGTGACAGCATGTCCCAGACGAGCTTATGC
AATGACAACTCCACTCTGCGCTCGGCACAGAAGCTCCggagattcatgatctatgtgcac
tcgaaagggatggtggtggacgacgagtacgtcatcatcggatcggccaacatcaaccag
aggtccatggaaggctgcagggacaccgagatcgccatgggcgcctaccagccacactac
aagtggtctgctgatcacggccaaggccctcctcgtggacagGTGTACGGGTACAGGATG
TCGCTGTGGGCGGAGCACCTTGGGGCGGTGGAGGAGTGCTTCGGGCGGCCGGAGACGGGG
GAGTGCGTGAGGCGGGTGAGGGAGATGGCGGAGGAGAACTGGAGGGCGTACGTGTCGCCG
GAGATGGAGGAGACGAAGGGGCACCTGATGTGTTACCCGTTGAAGGTGGACAAGGACGGC
CGCGTCCGCTCTCTCCCCGGCCACGACTGCTTCCCCGACGTCGGCGGCAAGGTCCTCGGC
ACTCAAACCTCGCTCCCCAATGCCCTCACCACCTAGTACCTGTACCATATCCCGCGTGAA
TATGAATATGAATGAATGCCACTGTTTTGT

CDS

1068 bp

>Os03t0840800-01 Similar to Phospholipase D.
ATGGGGAAAAGCTCCGCCGACTTGTCCGCCTCCTCGGAGTCGGCCgtgctcctgcacggc
gacctcgacatttggataaccgaggccaagtgcctccccaacatggacatcatgtcggag
cggatgcgccgcttcttcaccggctacggcgcctgcggctcctcgtgcggcggcaccggc
gacaacgcgcgccgggccggcggcggcgtcaggcccaagaagatcatcaccagcgacccc
tacgtctccgtctgcctcgccggcgccaccgtcgcgcagacgcgggtcatccccaactcc
gagaaccccaggtgggaggagcgcttccgcgtcgaggtcgcccacgccgtctccaggctc
gagttccacgtcaaggacaacgacgtcttcggcgcgcagctcatcggcgtcgcctccctc
cccgtcgacaggatcctctccggcgcccccgccgagggctggttccccatcgacggccac
tgcagcagcaaccccatgcggccgccgccggagctccgcctctccgtccagtacaggccc
atcgacgacaaccccctctacaggggcggcgccggcgccgtccccaacgcctacttccct
ctccgccgaggtggcggcgtcaccctctaccaggacgcccacgtcgccgacggcggcctc
ccggccatccagatcgccggcggaagggcgtacgagcacggccgatgctgggaggacatc
tgccactccatcgtggaggcgcaccacctcgtgtacatggtcggatggtccatctaccac
cccgtcaagctcgtcagggaGCCCACCCGGGCGCTCCCCGGCGAGACGCCATCGACGCTC
GGCGAGCTTCTCAAGAAAAGGGCTCGCGAGGGCGTCCGCATCGTCATCTTGCTCTGGGAC
GACAAGACGTCGCATGACAAGTTCCTTCTCAAAACGGTTGAATGCAGGATGGTGTCATGC
ATACACACGACGAGGAGACCAAAAAGTTTTTCAGGCATTCAGGTGTTCACTGTGTGCTGG
TTCCTCGCTATGCCAGCACTAAGCTTAGCATTTTCAAGCAGCAGgtag

Protein

356 aa

>Os03t0840800-01 Similar to Phospholipase D.
MGKSSADLSASSESAVLLHGDLDIWITEAKCLPNMDIMSERMRRFFTGYGACGSSCGGTG
DNARRAGGGVRPKKIITSDPYVSVCLAGATVAQTRVIPNSENPRWEERFRVEVAHAVSRL
EFHVKDNDVFGAQLIGVASLPVDRILSGAPAEGWFPIDGHCSSNPMRPPPELRLSVQYRP
IDDNPLYRGGAGAVPNAYFPLRRGGGVTLYQDAHVADGGLPAIQIAGGRAYEHGRCWEDI
CHSIVEAHHLVYMVGWSIYHPVKLVREPTRALPGETPSTLGELLKKRAREGVRIVILLWD
DKTSHDKFLLKTVECRMVSCIHTTRRPKSFSGIQVFTVCWFLAMPALSLAFSSSR*

5'UTR

chr03:35354777..35354897 (- strand) : 121 bp

CDS

chr03:35353841..35354776 (- strand) : 936 bp

chr03:35353587..35353714 (- strand) : 128 bp

chr03:35353229..35353232 (- strand) : 4 bp

3'UTR

chr03:35353038..35353228 (- strand) : 191 bp

chr03:35352582..35352842 (- strand) : 261 bp

chr03:35352429..35352497 (- strand) : 69 bp

chr03:35352195..35352342 (- strand) : 148 bp

chr03:35351717..35351865 (- strand) : 149 bp

chr03:35351291..35351461 (- strand) : 171 bp

chr03:35350970..35351173 (- strand) : 204 bp

chr03:35350196..35350543 (- strand) : 348 bp

FASTA

>Os03t0840800-01 class=Sequence position=chr03:35350196..35354897 (- strand)
CGTGCCCCCG CCCGCGCCGC CATCTCTCTC CTTCCTCCTG TATTGTTACG CAAGCCATCC GAGCCAAGCA GGAGAAGAGG
AAGAGGAAGA GGAAGAGGAA GAGCATGCCC CCCTGCGCGG CATGGGGAAA AGCTCCGCCG ACTTGTCCGC CTCCTCGGAG
TCGGCCgtgc tcctgcacgg cgacctcgac atttggataa ccgaggccaa gtgcctcccc aacatggaca tcatgtcgga
gcggatgcgc cgcttcttca ccggctacgg cgcctgcggc tcctcgtgcg gcggcaccgg cgacaacgcg cgccgggccg
gcggcggcgt caggcccaag aagatcatca ccagcgaccc ctacgtctcc gtctgcctcg ccggcgccac cgtcgcgcag
acgcgggtca tccccaactc cgagaacccc aggtgggagg agcgcttccg cgtcgaggtc gcccacgccg tctccaggct
cgagttccac gtcaaggaca acgacgtctt cggcgcgcag ctcatcggcg tcgcctccct ccccgtcgac aggatcctct
ccggcgcccc cgccgagggc tggttcccca tcgacggcca ctgcagcagc aaccccatgc ggccgccgcc ggagctccgc
ctctccgtcc agtacaggcc catcgacgac aaccccctct acaggggcgg cgccggcgcc gtccccaacg cctacttccc
tctccgccga ggtggcggcg tcaccctcta ccaggacgcc cacgtcgccg acggcggcct cccggccatc cagatcgccg
gcggaagggc gtacgagcac ggccgatgct gggaggacat ctgccactcc atcgtggagg cgcaccacct cgtgtacatg
gtcggatggt ccatctacca ccccgtcaag ctcgtcaggg aGCCCACCCG GGCGCTCCCC GGCGAGACGC CATCGACGCT
CGGCGAGCTT CTCAAGAAAA GGGCTCGCGA GGGCGTCCGC ATCGTCATCT TGCTCTGGGA CGACAAGACG TCGCATGACA
AGTTCCTTCT CAAAACGGTA GTATATCTAT CTATCATCTT TTTTATATCC TTTCTTCTTC TTCTTCTTCA GTTGTACTCT
CTGATGAATT GATATCGTCA AACTCACAAG AATTCGGAAA TGATATTGTG AGAAATAATT CAGGTTGAAT GCAGGATGGT
GTCATGCATA CACACGACGA GGAGACCAAA AAGTTTTTCA GGCATTCAGG TGTTCACTGT GTGCTGGTTC CTCGCTATGC
CAGCACTAAG CTTAGCATTT TCAAGCAGCA GGTCAGAAAT CTTTGTCTGA TATAGCGCTA TAATTTAACT GCCTCATTAG
TTATTACTAG TACATGAACA TAAGTATAGT AATTACTTGT TATTGAATAT AATACCTACT AGTACACACT ATCCAATTAT
GCCTGCTTTT ACAAATCACA TACAAGTAGG TTCTCACTAG TTCATGTTCT GTTGCTTATC TGCATTTGTC AGGATGAATA
GTCCTGATGT TCTTTCTGAG TCTGAGAAAG CTACACTAAA TATTCATGCA GCAAACTCAT GCCTTACCAT TTGTTCATTT
GCCTGTTAAT AGTTCATAAA AAACCTTTCG ATGATGCTTG CTAATGTAAT ATTTCTCTTC Tccaggtagt gggaacttta
tttacacatc atcagaaatg tgtgcttgtt gatacacaag ctactgggaa caaccgcaaa atcactgctt tcattggtgg
tctagacttg tgcgacggca gatacgatac acctgaacat aggcttttca aagatcttga taccgctttc aacaaggact
tccataatcc tacatttcct gtaagttctc cagttcataa gctgttatca gatcatggag ttccttcata gatgtttaca
caaattcatg tgaattgcta aatatctcca taaaatgtat tggcagcacg ttgtacaatc tgacttttct ataaaatata
tcttctctat ctgataagaa tatgaacgcc gaggatcctt tctcctgatc tacaggttaa ttcatatgga ccaagacagc
catggcatga tttacactgc aagattgagg gccctgctgc ctttgatata ctgacaaact ttgaacagcg gtggagaaaa
gcaaccaaat ggaaggtcaa tcttaagaaa gttgcaagtt ggcatcatga cacgctgata aaaataaacc ggatgtcctg
gattgttacc ccagctgcag atgaggctaa tgcacatgtt tgtgaagaaa aggacccaga aaattggcat gtgcaggtat
aagactttgt tttagtctta catgaactac agtaacatct tagatggtac ttcctcatac ttattttggt gctcggctag
gtgttcaggt caattgattc aggttctgta aaggggttcc caaaaattgt tcaggaggca gagtctcagg ttagtgtcct
ttgccatgca ccacagcacc agctaaaagt gcatctttca acaattgttt agttattttc ccttttcttc tgcagaatct
tgtctgtgca aagaatctaa agatcgacaa aagcatacac agtgcatatg tcaaagcaat caggtctgcg cagcacttca
tatacattga gaaccagtat ttcattgggt catcgttctt atggtcctca cataaaagcg caggtaaatc tgtcttcagt
tctgctttAG GTGAAGCTTA TGAAATGCCA TTTCACTACA AATTTCTTTG CTTGGCAACC AACAGTTAAC ATCTTGTAGT
TGTAGACTTG ATCAGCCTAA CAATCACATA CATGTTTATG CTATGACTTG CGAACAGCAA TTGGATTGTT CAGATGCACG
ATGGCAAACG ACACATTAGA ACCTGAAAAT GGCATAAGAG ATAGTAGGAT TAGTGTTTCA GTACCTGTCA GGCTGTTTGT
TACTCACATT TGGTAATGAC TACAAGGGCA TTCTGCATTC ATATTACGAT TGGAATGCTC TGGTGAGAtc aggtgctgat
aacttaatac ctgtggagct ggccttgaag attgcaagca agatcaaggc aaatgagcag ttcgcggtgt acattgtcct
accaatgtgg cctgaaggca tcccaaccgc ggcaccgatg cagcaaatcc tcttttggca ggtCTGCAGG CATTTATTCA
TGCAAATAAC tactacctcc gtttcaggtt ataagacttt ctaacattgc ccacattcat atagatgtta atgaatctag
gcacacatta acaaatgaat ctagacacat tcatttgtgc ctagattcat taacatctat atgaatgtgg acaatactag
aaagtcttat aatataaaac ggaggaagta CAAATTAATT AAGATACTGA TGTTTTGATC TGGTATTCTT TTGAAGAGCC
AAACAATGTC TATGATGTAC AAGATCATAG CGGACGCTCT GCAGATGCAG GGATTGGTTG AAGCTCACCC TCAAGATTAT
CTGAATTTCT ACTGCCTCGG CAAGCGCGAG GTCGCCGCCG GTGACAGCAT GTCCCAGACG AGCTTATGCA ATGACAACTC
CACTCTGGTA CAGTACAGCA GCAGGATACT ACTCCGTAGT CCGTAGTAGG TAAATGTATT ACTACTACGT GTGGTGAAAT
ACTCGTGGCT GATCATTGTT GCAAATTAAC AATCATGCAT CCAGCGCTCG GCACAGAAGC TCCggagatt catgatctat
gtgcactcga aagggatggt ggtggacgac gagtacgtca tcatcggatc ggccaacatc aaccagaggt ccatggaagg
ctgcagggac accgagatcg ccatgggcgc ctaccagcca cactacaagt ggtctgctga tcacggccaa ggccctcctc
gtggacaggt aCAGTTCATC CAAAGAGCTT CATTACGATC GATGACGAGA GAGAGAGAGA TGTGTGTTTG CATTGCAGat
gtagagaaac gaggattttc ttgctaactc cacaaggtgt tgaactagcc aacctaggtt caaaagcctc acccctttta
attatttgat attaggtAGG GTTCACTCTA TCGGTTTTAG CCCATTTGAT CGGAGTTCAC CGAAATCCCG AAATTTCGGA
AATTTTGGTC Cgaaattttg aacaaaattt agttgaattt gaacaaatat taccaaaatt cacgaaaaaa attaaaaaaa
tttagccgaa gtaatatcgt atcggagggg accaaaatga ccgaaatttc ggttcgaaat ttccaactct gatattaggt
tattcaCTAA TATTCACTTT TTTTTGCATT GCAGGTGTAC GGGTACAGGA TGTCGCTGTG GGCGGAGCAC CTTGGGGCGG
TGGAGGAGTG CTTCGGGCGG CCGGAGACGG GGGAGTGCGT GAGGCGGGTG AGGGAGATGG CGGAGGAGAA CTGGAGGGCG
TACGTGTCGC CGGAGATGGA GGAGACGAAG GGGCACCTGA TGTGTTACCC GTTGAAGGTG GACAAGGACG GCCGCGTCCG
CTCTCTCCCC GGCCACGACT GCTTCCCCGA CGTCGGCGGC AAGGTCCTCG GCACTCAAAC CTCGCTCCCC AATGCCCTCA
CCACCTAGTA CCTGTACCAT ATCCCGCGTG AATATGAATA TGAATGAATG CCACTGTTTT GT

Locus: Os03g0840800

Loading...

Locus: Os03g0840800

Loading...