Os03t0851300-01

Locus

Os03g0851300

Description

Winged helix repressor DNA-binding domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RPN5

CGSNL Gene Name

19S REGULATORY PARTICLE NON-ATPASE SUBUNIT 5

Oryzabase Gene Symbol Synonym(s)

OsRpn5, Rpn5

Oryzabase Gene Name Synonym(s)

19S regulatory particle non-ATPase subunit 5, RP non-ATPase 5

Transcript Evidence

AK071162 (DDBJ, Best hit)

Protein Evidence

B3TM04 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Proteasome component (PCI) domain (IPR000717)

Winged helix-turn-helix transcription repressor DNA-binding (IPR011991)

Full-length cDNA

J023081N11 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0851300-01)

RiceXPro (AK071162)

Others

Oryzabase (20565)

KEGG (Os03t0851300-01)

Transcript

1888 bp

>Os03t0851300-01 Winged helix repressor DNA-binding domain containing protein.
CAAAACGGCCACCACCACACCACAGAGAGCCCGAGAGCCCTACTCCCCTTCTCTCCTCTT
CTTCCTCTCCCGCAAGCAAAGCGCACGCCGCCTTTGCCTTAGATCTCCTCGACTCCGCCG
CCGCCGCCGGCGCCTCCCCACGGTCCCTCCCTCGCCATGGAGGGTAACAGTACCAACCTC
GATGCGGCGATAGAGTCGCTCCTCAACGTGGAGAAGCAGATGAGGCTGGCCGGCGATGTC
GCCGGCACGAGGAAGGCCGCCATCGACATCGTCGAGCTCTGCTACAAGGCCGGCGCCTGG
AAGACGCTCAACGATCAGATCGTGGTCCTCTCCAAGAGGAGGGGCCAGCTTAAGCAGGCT
ATCACTGCCATGGTTCAGAAAGCAATGGAGTACATTGACTTAACGCCAGACATGGACACA
CGTATTGAGCTAATCAAGACGTTGAGCAGTGTATCTGCTGGAAAAATATATGTGGAGATA
GAGAGAGCAAGATTGATCAAAAGACTTGCAAAAATCAAAGAGGAGCAGGGACAGATTGAT
GAGGCTGCTGATTTAATGCAAGAAGTTGCTGTTGAAACATTTGGCTCCATGGCAAAGACA
GAAAAGATTGCATTCATTCTAGAGCAGGTCCGGCTGTGCTTGGATCGTCAAGATTATGTA
CGCGCACAGATTTTATCCAGGAAAATCAGTCCTAGGGTATTTGATGCAGACCCGTCAAAG
GAAAAAAAGAAACCGAAAGAAGGTGATAATATTGTTCAGGAAGCCCCAGCAGAGATACCT
TCCCTCCTGGAACTGAAGCGCATCTACTATGAACTGATGATTCGCTATTACTCGCACAAC
AATGATTACCTGGAAATCTGCCGTTGCTACAAGTCGATTTATGAAATTCCATCAATAAAA
GAGGATCCATCAAAGTGGATACCGGTTCTTAGAAAGATCTGTTGGTATTTGGTGTTGGCG
CCTCATGATCCGATGCAATCAAGCCTTCTCAATGCCACACTCGAAGACAAAAATCTCTCC
GAGATACCAAATTTCCGGTTACTGCTGAAGCAACTTGTAACCATGGAGGTGATTCAGTGG
ACAAGCTTGTGGGAATTCTTTAAAGATGAATATGCGAATGAGAAGAATTTTCTCGGAGGA
GCTTTGGGTGACAAAGCTGCAGAGGATCTGAAATTGAGGATCATTGAACATAATATCTTG
GTTGTTTCGAAGTACTATTCAAGGATTACCCTGAAGAGGCTCGCAGATCTTCTTTGCTTG
AGCTTGCAGGAGGCAGAGAAACACCTTTCGGACATGGTAAACTCAAAGTCGCTGATTGCG
AAGATTGACAGGCCAATGGGTGTTGTATGCTTCCGCACAGCACAAGACAGTAATGGTATA
CTCAATTCCTGGGCGGCGAACCTCGAGAAACTCCTCGATCTTGTTGAGAAGAGCTGTCAC
CAAATACACAAGGAGACGATGATCCATAAGGCGGTGTTGAAAGCTTAATCTGTAAACCAT
TTTGCATTGGCTGGCTTGCTTAGGTTCTCTGCCTGGCCTTCTATGGTCAAATTTTACAAT
CACAGGACGTCAAGCTTTTCTCAGCTCAAGCATCACCTGTTTGCTTTGGGAACTCGTGCG
TGAATGATCTTAAATACTGTGACCACAGAATGATGACATATTATTTGTTGTTGGGGTTCA
ATCGCTGTCCTCCAATTTGCTTAACATGTGTATCTTCCCGAATATTATTTGAATTCTAGA
TTATTCAATCAGATGCCTGGCTTGTTTTAGGTTCTGCAGATGCGCTGGTTCTCAATATGA
TCTGATCTGTAACGCGTTCGTTGTGATTTTAAGTTTCTGGAGATGCATCATATGTGGAGA
AGATAAAACTGGAGATCTTGTCGTTTGC

CDS

1332 bp

>Os03t0851300-01 Winged helix repressor DNA-binding domain containing protein.
ATGGAGGGTAACAGTACCAACCTCGATGCGGCGATAGAGTCGCTCCTCAACGTGGAGAAG
CAGATGAGGCTGGCCGGCGATGTCGCCGGCACGAGGAAGGCCGCCATCGACATCGTCGAG
CTCTGCTACAAGGCCGGCGCCTGGAAGACGCTCAACGATCAGATCGTGGTCCTCTCCAAG
AGGAGGGGCCAGCTTAAGCAGGCTATCACTGCCATGGTTCAGAAAGCAATGGAGTACATT
GACTTAACGCCAGACATGGACACACGTATTGAGCTAATCAAGACGTTGAGCAGTGTATCT
GCTGGAAAAATATATGTGGAGATAGAGAGAGCAAGATTGATCAAAAGACTTGCAAAAATC
AAAGAGGAGCAGGGACAGATTGATGAGGCTGCTGATTTAATGCAAGAAGTTGCTGTTGAA
ACATTTGGCTCCATGGCAAAGACAGAAAAGATTGCATTCATTCTAGAGCAGGTCCGGCTG
TGCTTGGATCGTCAAGATTATGTACGCGCACAGATTTTATCCAGGAAAATCAGTCCTAGG
GTATTTGATGCAGACCCGTCAAAGGAAAAAAAGAAACCGAAAGAAGGTGATAATATTGTT
CAGGAAGCCCCAGCAGAGATACCTTCCCTCCTGGAACTGAAGCGCATCTACTATGAACTG
ATGATTCGCTATTACTCGCACAACAATGATTACCTGGAAATCTGCCGTTGCTACAAGTCG
ATTTATGAAATTCCATCAATAAAAGAGGATCCATCAAAGTGGATACCGGTTCTTAGAAAG
ATCTGTTGGTATTTGGTGTTGGCGCCTCATGATCCGATGCAATCAAGCCTTCTCAATGCC
ACACTCGAAGACAAAAATCTCTCCGAGATACCAAATTTCCGGTTACTGCTGAAGCAACTT
GTAACCATGGAGGTGATTCAGTGGACAAGCTTGTGGGAATTCTTTAAAGATGAATATGCG
AATGAGAAGAATTTTCTCGGAGGAGCTTTGGGTGACAAAGCTGCAGAGGATCTGAAATTG
AGGATCATTGAACATAATATCTTGGTTGTTTCGAAGTACTATTCAAGGATTACCCTGAAG
AGGCTCGCAGATCTTCTTTGCTTGAGCTTGCAGGAGGCAGAGAAACACCTTTCGGACATG
GTAAACTCAAAGTCGCTGATTGCGAAGATTGACAGGCCAATGGGTGTTGTATGCTTCCGC
ACAGCACAAGACAGTAATGGTATACTCAATTCCTGGGCGGCGAACCTCGAGAAACTCCTC
GATCTTGTTGAGAAGAGCTGTCACCAAATACACAAGGAGACGATGATCCATAAGGCGGTG
TTGAAAGCTTAA

Protein

444 aa

>Os03t0851300-01 Winged helix repressor DNA-binding domain containing protein.
MEGNSTNLDAAIESLLNVEKQMRLAGDVAGTRKAAIDIVELCYKAGAWKTLNDQIVVLSK
RRGQLKQAITAMVQKAMEYIDLTPDMDTRIELIKTLSSVSAGKIYVEIERARLIKRLAKI
KEEQGQIDEAADLMQEVAVETFGSMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPR
VFDADPSKEKKKPKEGDNIVQEAPAEIPSLLELKRIYYELMIRYYSHNNDYLEICRCYKS
IYEIPSIKEDPSKWIPVLRKICWYLVLAPHDPMQSSLLNATLEDKNLSEIPNFRLLLKQL
VTMEVIQWTSLWEFFKDEYANEKNFLGGALGDKAAEDLKLRIIEHNILVVSKYYSRITLK
RLADLLCLSLQEAEKHLSDMVNSKSLIAKIDRPMGVVCFRTAQDSNGILNSWAANLEKLL
DLVEKSCHQIHKETMIHKAVLKA*

5'UTR

chr03:35837840..35837995 (- strand) : 156 bp

CDS

chr03:35837837..35837839 (- strand) : 3 bp

chr03:35837466..35837663 (- strand) : 198 bp

chr03:35836639..35836746 (- strand) : 108 bp

chr03:35836445..35836549 (- strand) : 105 bp

chr03:35836285..35836341 (- strand) : 57 bp

chr03:35836008..35836204 (- strand) : 197 bp

chr03:35835302..35835401 (- strand) : 100 bp

chr03:35835094..35835206 (- strand) : 113 bp

chr03:35834853..35835006 (- strand) : 154 bp

chr03:35834687..35834764 (- strand) : 78 bp

chr03:35834374..35834592 (- strand) : 219 bp

3'UTR

chr03:35833974..35834373 (- strand) : 400 bp

FASTA

>Os03t0851300-01 class=Sequence position=chr03:35833974..35837995 (- strand)
CAAAACGGCC ACCACCACAC CACAGAGAGC CCGAGAGCCC TACTCCCCTT CTCTCCTCTT CTTCCTCTCC CGCAAGCAAA
GCGCACGCCG CCTTTGCCTT AGATCTCCTC GACTCCGCCG CCGCCGCCGG CGCCTCCCCA CGGTCCCTCC CTCGCCATGG
TGAGCTCACC TCCCTCCTCC CCTCCCCCAC CCCGACCCTC CGCCCGCCTC TCCGGGGTTT TGGCCTTCCC GCCCGCCCCG
CCGCGGCCCG CACTTCTCAT CTAGGGTTTC GATCTCTTGC GGGTTGATCT GATGCCTTGC AATCTGACCC TGTTTCTTGT
GGACCGATGC AGGAGGGTAA CAGTACCAAC CTCGATGCGG CGATAGAGTC GCTCCTCAAC GTGGAGAAGC AGATGAGGCT
GGCCGGCGAT GTCGCCGGCA CGAGGAAGGC CGCCATCGAC ATCGTCGAGC TCTGCTACAA GGCCGGCGCC TGGAAGACGC
TCAACGATCA GATCGTGGTC CTCTCCAAGA GGAGGGGCCA GCTTAAGCAG GTCAAGCTCT CGTCCTCTCC TATCTTTGGA
CTTCGTTTAG TAGTTCTAGT TGAATTACTA GCTGTATTTA GCTATCTAAC TGATATCTTC AAAGTTATAC TCTACTGACT
AGAGGCACAT GCAAACCCCA AAGTTTCCGA GGAGCACATG TAATTGAGGC TAACATAGCA TACCCACCTG CTATTATGTT
GTCACTCTGA ATCACCAGCC ATTGATTTTA TTTTTGTAAT CTTGGTATGA ACTTAGAGTT ATTCTAAGTT CTAGTGATCT
TAAATAGATT ACACAATTCA AATTATCAAC GCTCACTGAA AGACAATAGT CATATTTTGC TCGATGTAAT TGGATATATG
CCCTTATTTC TAAGGGATAC TGGTGGTAGG GAAGGCATGC CATAGTGTTG TGTAAGATTA CTCTTTTCTT TGCAAAGCAT
TATGTGTTTA GGTTGAGTTT CAACTAATGT TTTGTTGAGT GCTAATCGAG TGCATTGTAT ATTTCACTTC GAAACAATAT
TTGCATGCAT TTTTCTCCCC CCAAAATTTC AGCATTGTCT CTCCATATCC CATACTTAGG TCTTCCTGAA ATATCCAGTT
ATTATTTACA AGTTGAACAA TATTTCATAA ATCATGCCTG TTTATGTATG CAATACTATT GCTGCTGCAT TATAACTTGG
TTATGCACAT GTGGCATGTC TCAACTCTTC TAATTCTTTA TTTTTACAGG CTATCACTGC CATGGTTCAG AAAGCAATGG
AGTACATTGA CTTAACGCCA GACATGGACA CACGTATTGA GCTAATCAAG ACGTTGAGCA GTGTATCTGC TGGAAAAGTG
AGAATCATGG CTACTCAAAT ATTGCTTACC TATAAGATTT AATGCCCTTT CATGTGTGTA ATCTCACTGA TATGCATCAA
CTGTAGATAT ATGTGGAGAT AGAGAGAGCA AGATTGATCA AAAGACTTGC AAAAATCAAA GAGGAGCAGG GACAGATTGA
TGAGGCTGCT GATTTAATGC AAGAAGTTGC TGTAAGTTCA AGCTGCACTA TAATCATGGC ACACAGTTAC ATCTACTATA
ACCACCATAG TGTTGTCTTC GCATCTACAT AATGTCTAAC AAGTTCATCC TCAGGTTGAA ACATTTGGCT CCATGGCAAA
GACAGAAAAG ATTGCATTCA TTCTAGAGCA GGTATGAAGA AATACAGTAA TAAAGCTTGA AATTGTTACA AAAGCCTGGG
TTCTGGAATC TTACTGTAAT CATGATCACA GGTCCGGCTG TGCTTGGATC GTCAAGATTA TGTACGCGCA CAGATTTTAT
CCAGGAAAAT CAGTCCTAGG GTATTTGATG CAGACCCGTC AAAGGAAAAA AAGAAACCGA AAGAAGGTGA TAATATTGTT
CAGGAAGCCC CAGCAGAGAT ACCTTCCCTC CTGGAACTGA AGCGCATCTA CTATGAACTG ATGATTCGGT ATGTCTTCCT
GCTCAGTGAG ACTAATTCAT CATGAGTTCA TGTCGCTTCT AGTAATGTTG GTTGAAGTTA ATGCtacccc ctcaggtcgc
aaaatatagc tacctttagc tatgaatatg gacaagttca gattcacaga taaaggtagc tatattttgg gatggaggga
gtTCTATTTT GTTCAGCAAA GAATTGCTTT CGACTGTTTG ATTCATGATC TAATACATAG TGATAGTTAA CTATTTAGAG
TTTTCTGCTA AGTCAATCTA ATGCTTGGTT GATTAAACAA AAGAACTAAT GTGGTGTCAT ATCCCTTACT GCTATTAGAC
AATTGTTTAT GTAGCTTGTA TTTTATTTAC TCAGGAAATA TCAATTCCTC TTCTGCGGTT ACCTGTCAAA TATGTTTGCG
ATTGTTTACC ATCATCATGT TATGGTTACT GCTTGAATGC CTTATTTGTA TCCATCAACC TTTTTTTATG CTACAATTAT
GAATACTGTA TTTGTGCTGT TTGAATTCTC GCTAACTGAT TTTATAACCT GCTAAGAGTA TATATTTTTT TCTATATATG
TGGTGAAACA TGATTTCTGT TTGTCTCTAT TCAGCTATTA CTCGCACAAC AATGATTACC TGGAAATCTG CCGTTGCTAC
AAGTCGATTT ATGAAATTCC ATCAATAAAA GAGGATCCAT CAAAGTGGAT ACCGGTAAAG CTCTCTCATT CGCAAGTCTT
ACTTGGTGTG GTGTGTGCGC ATACTCACTC ACGCTATAAT GGTTATCTGA CTGCCTGAAT TCGCTTTAGG TTCTTAGAAA
GATCTGTTGG TATTTGGTGT TGGCGCCTCA TGATCCGATG CAATCAAGCC TTCTCAATGC CACACTCGAA GACAAAAATC
TCTCCGAGAT ACCAAATTTC CGGTACGTTA TGTTGCTTTC AGGATTACAA ATTATCATGG TTTTTAATGT TCTTTCTAAT
TCCTACTTTT GCTGTTTGGA TGGGAATAGG TTACTGCTGA AGCAACTTGT AACCATGGAG GTGATTCAGT GGACAAGCTT
GTGGGAATTC TTTAAAGATG AATATGCGAA TGAGAAGAAT TTTCTCGGAG GAGCTTTGGG TGACAAAGCT GCAGAGGATC
TGAAATTGAG GATCATTGAA CATGTATTGC TTACTTGACT TTATCGTATT TCTCTTTTGG TTCCTTGCTT TGTATTTGTC
AGTTGATTTC CAGTTCTTTG CTTTTGTTCA GAATATCTTG GTTGTTTCGA AGTACTATTC AAGGATTACC CTGAAGAGGC
TCGCAGATCT TCTTTGCTTG AGCTTGCAGG TTTGTGTTCC CAGCCTTCCT AGCATCACTT GTATTCCTCT TGTTACTTTG
TAGCCTACCA AGATCTAACA TGCCCCACAT TTTTCTCATT CAGGAGGCAG AGAAACACCT TTCGGACATG GTAAACTCAA
AGTCGCTGAT TGCGAAGATT GACAGGCCAA TGGGTGTTGT ATGCTTCCGC ACAGCACAAG ACAGTAATGG TATACTCAAT
TCCTGGGCGG CGAACCTCGA GAAACTCCTC GATCTTGTTG AGAAGAGCTG TCACCAAATA CACAAGGAGA CGATGATCCA
TAAGGCGGTG TTGAAAGCTT AATCTGTAAA CCATTTTGCA TTGGCTGGCT TGCTTAGGTT CTCTGCCTGG CCTTCTATGG
TCAAATTTTA CAATCACAGG ACGTCAAGCT TTTCTCAGCT CAAGCATCAC CTGTTTGCTT TGGGAACTCG TGCGTGAATG
ATCTTAAATA CTGTGACCAC AGAATGATGA CATATTATTT GTTGTTGGGG TTCAATCGCT GTCCTCCAAT TTGCTTAACA
TGTGTATCTT CCCGAATATT ATTTGAATTC TAGATTATTC AATCAGATGC CTGGCTTGTT TTAGGTTCTG CAGATGCGCT
GGTTCTCAAT ATGATCTGAT CTGTAACGCG TTCGTTGTGA TTTTAAGTTT CTGGAGATGC ATCATATGTG GAGAAGATAA
AACTGGAGAT CTTGTCGTTT GC

Locus: Os03g0851300

Loading...

Locus: Os03g0851300

Loading...