Os03t0851300-02

Locus

Os03g0851300

Description

Winged helix repressor DNA-binding domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RPN5

CGSNL Gene Name

19S REGULATORY PARTICLE NON-ATPASE SUBUNIT 5

Oryzabase Gene Symbol Synonym(s)

OsRpn5, Rpn5

Oryzabase Gene Name Synonym(s)

19S regulatory particle non-ATPase subunit 5, RP non-ATPase 5

Transcript Evidence

AK073581 (DDBJ, Best hit)

Protein Evidence

B3TM04 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Proteasome component (PCI) domain (IPR000717)

Winged helix-turn-helix transcription repressor DNA-binding (IPR011991)

Full-length cDNA

J033048G13 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0851300-02)

RiceXPro (AK073581)

Others

Oryzabase (20565)

KEGG (Os03t0851300-02)

Transcript

1646 bp

>Os03t0851300-02 Winged helix repressor DNA-binding domain containing protein.
AGAGCCCTACTCCCCTTCTCTCCTCTTCTTCCTCTCCCGCAAGCAAAGCGCACGCCGCCT
TTGCCTTAGATCTCCTCGACTCCGCCGCCGCCGCCGGCGCCTCCCCACGGTCCCTCCCTC
GCCATGGAGGGTAACAGTACCAACCTCGATGCGGCGATAGAGTCGCTCCTCAACGTGGAG
AAGCAGATGAGGCTGGCCGGCGATGTCGCCGGCACGAGGAAGGCCGCCATCGACATCGTC
GAGCTCTGCTACAAGGCCGGCGCCTGGAAGACGCTCAACGATCAGATCGTGGTCCTCTCC
AAGAGGAGGGGCCAGCTTAAGCAGGCTATCACTGCCATGGTTCAGAAAGCAATGGAGTAC
ATTGACTTAACGCCAGACATGGACACACGTATTGAGCTAATCAAGACGTTGAGCAGTGTA
TCTGCTGGAAAAATATATGTGGAGATAGAGAGAGCAAGATTGATCAAAAGACTTGCAAAA
ATCAAAGAGGAGCAGGGACAGATTGATGAGGCTGCTGATTTAATGCAAGAAGTTGCTGTT
GAAACATTTGGCTCCATGGCAAAGACAGAAAAGATTGCATTCATTCTAGAGCAGGTCCGG
CTGTGCTTGGATCGTCAAGATTATGTACGCGCACAGATTTTATCCAGGAAAATCAGTCCT
AGGGTATTTGATGCAGACCCGTCAAAGGAAAAAAAGAAACCGAAAGAAGGTGATAATATT
GTTCAGGAAGCCCCAGCAGAGATACCTTCCCTCCTGGAACTGAAGCGCATCTACTATGAA
CTGATGATTCGCTATTACTCGCACAACAATGATTACCTGGAAATCTGCCGTTGCTACAAG
TCGATTTATGAAATTCCATCAATAAAAGAGGATCCATCAAAGTGGATACCGGTTCTTAGA
AAGATCTGTTGGTATTTGGTGTTGGCGCCTCATGATCCGATGCAATCAAGCCTTCTCAAT
GCCACACTCGAAGACAAAAATCTCTCCGAGATACCAAATTTCCGGTTACTGCTGAAGCAA
CTTGTAACCATGGAGGTGATTCAGTGGACAAGCTTGTGGGAATTCTTTAAAGATGAATAT
GCGAATGAGAAGAATTTTCTCGGAGGAGCTTTGGGTGACAAAGCTGCAGAGGATCTGAAA
TTGAGGATCATTGAACATAATATCTTGGTTGTTTCGAAGTACTATTCAAGGATTACCCTG
AAGAGGCTCGCAGATCTTCTTTGCTTGAGCTTGCAGGAGGCAGAGAAACACCTTTCGGAC
ATGGTAAACTCAAAGTCGCTGATTGCGAAGATTGACAGGCCAATGGGTGTTGTATGCTTC
CGCACAGCACAAGACAGTAATGGTATACTCAATTCCTGGGCGGCGAACCTCGAGAAACTC
CTCGATCTTGTTGAGAAGAGCTGTCACCAAATACACAAGGAGACGATGATCCATAAGGCG
GTGTTGAAAGCTTAATCTGTAAACCATTTTGCATTGGCTGGCTTGCTTAGGTTCTCTGCC
TGGCCTTCTATGGTCAAATTTTACAATCACAGGACGTCAAGCTTTTCTCAGCTCAAGCAT
CACCTGTTTGCTTTGGGAACTCGTGCGTGAATGATCTTAAATACTGTGACCACAGAATGA
TGACATATTATTTGTTGTTGGGGTTC

CDS

1332 bp

>Os03t0851300-02 Winged helix repressor DNA-binding domain containing protein.
ATGGAGGGTAACAGTACCAACCTCGATGCGGCGATAGAGTCGCTCCTCAACGTGGAGAAG
CAGATGAGGCTGGCCGGCGATGTCGCCGGCACGAGGAAGGCCGCCATCGACATCGTCGAG
CTCTGCTACAAGGCCGGCGCCTGGAAGACGCTCAACGATCAGATCGTGGTCCTCTCCAAG
AGGAGGGGCCAGCTTAAGCAGGCTATCACTGCCATGGTTCAGAAAGCAATGGAGTACATT
GACTTAACGCCAGACATGGACACACGTATTGAGCTAATCAAGACGTTGAGCAGTGTATCT
GCTGGAAAAATATATGTGGAGATAGAGAGAGCAAGATTGATCAAAAGACTTGCAAAAATC
AAAGAGGAGCAGGGACAGATTGATGAGGCTGCTGATTTAATGCAAGAAGTTGCTGTTGAA
ACATTTGGCTCCATGGCAAAGACAGAAAAGATTGCATTCATTCTAGAGCAGGTCCGGCTG
TGCTTGGATCGTCAAGATTATGTACGCGCACAGATTTTATCCAGGAAAATCAGTCCTAGG
GTATTTGATGCAGACCCGTCAAAGGAAAAAAAGAAACCGAAAGAAGGTGATAATATTGTT
CAGGAAGCCCCAGCAGAGATACCTTCCCTCCTGGAACTGAAGCGCATCTACTATGAACTG
ATGATTCGCTATTACTCGCACAACAATGATTACCTGGAAATCTGCCGTTGCTACAAGTCG
ATTTATGAAATTCCATCAATAAAAGAGGATCCATCAAAGTGGATACCGGTTCTTAGAAAG
ATCTGTTGGTATTTGGTGTTGGCGCCTCATGATCCGATGCAATCAAGCCTTCTCAATGCC
ACACTCGAAGACAAAAATCTCTCCGAGATACCAAATTTCCGGTTACTGCTGAAGCAACTT
GTAACCATGGAGGTGATTCAGTGGACAAGCTTGTGGGAATTCTTTAAAGATGAATATGCG
AATGAGAAGAATTTTCTCGGAGGAGCTTTGGGTGACAAAGCTGCAGAGGATCTGAAATTG
AGGATCATTGAACATAATATCTTGGTTGTTTCGAAGTACTATTCAAGGATTACCCTGAAG
AGGCTCGCAGATCTTCTTTGCTTGAGCTTGCAGGAGGCAGAGAAACACCTTTCGGACATG
GTAAACTCAAAGTCGCTGATTGCGAAGATTGACAGGCCAATGGGTGTTGTATGCTTCCGC
ACAGCACAAGACAGTAATGGTATACTCAATTCCTGGGCGGCGAACCTCGAGAAACTCCTC
GATCTTGTTGAGAAGAGCTGTCACCAAATACACAAGGAGACGATGATCCATAAGGCGGTG
TTGAAAGCTTAA

Protein

444 aa

>Os03t0851300-02 Winged helix repressor DNA-binding domain containing protein.
MEGNSTNLDAAIESLLNVEKQMRLAGDVAGTRKAAIDIVELCYKAGAWKTLNDQIVVLSK
RRGQLKQAITAMVQKAMEYIDLTPDMDTRIELIKTLSSVSAGKIYVEIERARLIKRLAKI
KEEQGQIDEAADLMQEVAVETFGSMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPR
VFDADPSKEKKKPKEGDNIVQEAPAEIPSLLELKRIYYELMIRYYSHNNDYLEICRCYKS
IYEIPSIKEDPSKWIPVLRKICWYLVLAPHDPMQSSLLNATLEDKNLSEIPNFRLLLKQL
VTMEVIQWTSLWEFFKDEYANEKNFLGGALGDKAAEDLKLRIIEHNILVVSKYYSRITLK
RLADLLCLSLQEAEKHLSDMVNSKSLIAKIDRPMGVVCFRTAQDSNGILNSWAANLEKLL
DLVEKSCHQIHKETMIHKAVLKA*

5'UTR

chr03:35837840..35837962 (- strand) : 123 bp

CDS

chr03:35837837..35837839 (- strand) : 3 bp

chr03:35837466..35837663 (- strand) : 198 bp

chr03:35836639..35836746 (- strand) : 108 bp

chr03:35836445..35836549 (- strand) : 105 bp

chr03:35836285..35836341 (- strand) : 57 bp

chr03:35836008..35836204 (- strand) : 197 bp

chr03:35835302..35835401 (- strand) : 100 bp

chr03:35835094..35835206 (- strand) : 113 bp

chr03:35834853..35835006 (- strand) : 154 bp

chr03:35834687..35834764 (- strand) : 78 bp

chr03:35834374..35834592 (- strand) : 219 bp

3'UTR

chr03:35834183..35834373 (- strand) : 191 bp

FASTA

>Os03t0851300-02 class=Sequence position=chr03:35834183..35837962 (- strand)
AGAGCCCTAC TCCCCTTCTC TCCTCTTCTT CCTCTCCCGC AAGCAAAGCG CACGCCGCCT TTGCCTTAGA TCTCCTCGAC
TCCGCCGCCG CCGCCGGCGC CTCCCCACGG TCCCTCCCTC GCCATGGTGA GCTCACCTCC CTCCTCCCCT CCCCCACCCC
GACCCTCCGC CCGCCTCTCC GGGGTTTTGG CCTTCCCGCC CGCCCCGCCG CGGCCCGCAC TTCTCATCTA GGGTTTCGAT
CTCTTGCGGG TTGATCTGAT GCCTTGCAAT CTGACCCTGT TTCTTGTGGA CCGATGCAGG AGGGTAACAG TACCAACCTC
GATGCGGCGA TAGAGTCGCT CCTCAACGTG GAGAAGCAGA TGAGGCTGGC CGGCGATGTC GCCGGCACGA GGAAGGCCGC
CATCGACATC GTCGAGCTCT GCTACAAGGC CGGCGCCTGG AAGACGCTCA ACGATCAGAT CGTGGTCCTC TCCAAGAGGA
GGGGCCAGCT TAAGCAGGTC AAGCTCTCGT CCTCTCCTAT CTTTGGACTT CGTTTAGTAG TTCTAGTTGA ATTACTAGCT
GTATTTAGCT ATCTAACTGA TATCTTCAAA GTTATACTCT ACTGACTAGA GGCACATGCA AACCCCAAAG TTTCCGAGGA
GCACATGTAA TTGAGGCTAA CATAGCATAC CCACCTGCTA TTATGTTGTC ACTCTGAATC ACCAGCCATT GATTTTATTT
TTGTAATCTT GGTATGAACT TAGAGTTATT CTAAGTTCTA GTGATCTTAA ATAGATTACA CAATTCAAAT TATCAACGCT
CACTGAAAGA CAATAGTCAT ATTTTGCTCG ATGTAATTGG ATATATGCCC TTATTTCTAA GGGATACTGG TGGTAGGGAA
GGCATGCCAT AGTGTTGTGT AAGATTACTC TTTTCTTTGC AAAGCATTAT GTGTTTAGGT TGAGTTTCAA CTAATGTTTT
GTTGAGTGCT AATCGAGTGC ATTGTATATT TCACTTCGAA ACAATATTTG CATGCATTTT TCTCCCCCCA AAATTTCAGC
ATTGTCTCTC CATATCCCAT ACTTAGGTCT TCCTGAAATA TCCAGTTATT ATTTACAAGT TGAACAATAT TTCATAAATC
ATGCCTGTTT ATGTATGCAA TACTATTGCT GCTGCATTAT AACTTGGTTA TGCACATGTG GCATGTCTCA ACTCTTCTAA
TTCTTTATTT TTACAGGCTA TCACTGCCAT GGTTCAGAAA GCAATGGAGT ACATTGACTT AACGCCAGAC ATGGACACAC
GTATTGAGCT AATCAAGACG TTGAGCAGTG TATCTGCTGG AAAAGTGAGA ATCATGGCTA CTCAAATATT GCTTACCTAT
AAGATTTAAT GCCCTTTCAT GTGTGTAATC TCACTGATAT GCATCAACTG TAGATATATG TGGAGATAGA GAGAGCAAGA
TTGATCAAAA GACTTGCAAA AATCAAAGAG GAGCAGGGAC AGATTGATGA GGCTGCTGAT TTAATGCAAG AAGTTGCTGT
AAGTTCAAGC TGCACTATAA TCATGGCACA CAGTTACATC TACTATAACC ACCATAGTGT TGTCTTCGCA TCTACATAAT
GTCTAACAAG TTCATCCTCA GGTTGAAACA TTTGGCTCCA TGGCAAAGAC AGAAAAGATT GCATTCATTC TAGAGCAGGT
ATGAAGAAAT ACAGTAATAA AGCTTGAAAT TGTTACAAAA GCCTGGGTTC TGGAATCTTA CTGTAATCAT GATCACAGGT
CCGGCTGTGC TTGGATCGTC AAGATTATGT ACGCGCACAG ATTTTATCCA GGAAAATCAG TCCTAGGGTA TTTGATGCAG
ACCCGTCAAA GGAAAAAAAG AAACCGAAAG AAGGTGATAA TATTGTTCAG GAAGCCCCAG CAGAGATACC TTCCCTCCTG
GAACTGAAGC GCATCTACTA TGAACTGATG ATTCGGTATG TCTTCCTGCT CAGTGAGACT AATTCATCAT GAGTTCATGT
CGCTTCTAGT AATGTTGGTT GAAGTTAATG Ctaccccctc aggtcgcaaa atatagctac ctttagctat gaatatggac
aagttcagat tcacagataa aggtagctat attttgggat ggagggagtT CTATTTTGTT CAGCAAAGAA TTGCTTTCGA
CTGTTTGATT CATGATCTAA TACATAGTGA TAGTTAACTA TTTAGAGTTT TCTGCTAAGT CAATCTAATG CTTGGTTGAT
TAAACAAAAG AACTAATGTG GTGTCATATC CCTTACTGCT ATTAGACAAT TGTTTATGTA GCTTGTATTT TATTTACTCA
GGAAATATCA ATTCCTCTTC TGCGGTTACC TGTCAAATAT GTTTGCGATT GTTTACCATC ATCATGTTAT GGTTACTGCT
TGAATGCCTT ATTTGTATCC ATCAACCTTT TTTTATGCTA CAATTATGAA TACTGTATTT GTGCTGTTTG AATTCTCGCT
AACTGATTTT ATAACCTGCT AAGAGTATAT ATTTTTTTCT ATATATGTGG TGAAACATGA TTTCTGTTTG TCTCTATTCA
GCTATTACTC GCACAACAAT GATTACCTGG AAATCTGCCG TTGCTACAAG TCGATTTATG AAATTCCATC AATAAAAGAG
GATCCATCAA AGTGGATACC GGTAAAGCTC TCTCATTCGC AAGTCTTACT TGGTGTGGTG TGTGCGCATA CTCACTCACG
CTATAATGGT TATCTGACTG CCTGAATTCG CTTTAGGTTC TTAGAAAGAT CTGTTGGTAT TTGGTGTTGG CGCCTCATGA
TCCGATGCAA TCAAGCCTTC TCAATGCCAC ACTCGAAGAC AAAAATCTCT CCGAGATACC AAATTTCCGG TACGTTATGT
TGCTTTCAGG ATTACAAATT ATCATGGTTT TTAATGTTCT TTCTAATTCC TACTTTTGCT GTTTGGATGG GAATAGGTTA
CTGCTGAAGC AACTTGTAAC CATGGAGGTG ATTCAGTGGA CAAGCTTGTG GGAATTCTTT AAAGATGAAT ATGCGAATGA
GAAGAATTTT CTCGGAGGAG CTTTGGGTGA CAAAGCTGCA GAGGATCTGA AATTGAGGAT CATTGAACAT GTATTGCTTA
CTTGACTTTA TCGTATTTCT CTTTTGGTTC CTTGCTTTGT ATTTGTCAGT TGATTTCCAG TTCTTTGCTT TTGTTCAGAA
TATCTTGGTT GTTTCGAAGT ACTATTCAAG GATTACCCTG AAGAGGCTCG CAGATCTTCT TTGCTTGAGC TTGCAGGTTT
GTGTTCCCAG CCTTCCTAGC ATCACTTGTA TTCCTCTTGT TACTTTGTAG CCTACCAAGA TCTAACATGC CCCACATTTT
TCTCATTCAG GAGGCAGAGA AACACCTTTC GGACATGGTA AACTCAAAGT CGCTGATTGC GAAGATTGAC AGGCCAATGG
GTGTTGTATG CTTCCGCACA GCACAAGACA GTAATGGTAT ACTCAATTCC TGGGCGGCGA ACCTCGAGAA ACTCCTCGAT
CTTGTTGAGA AGAGCTGTCA CCAAATACAC AAGGAGACGA TGATCCATAA GGCGGTGTTG AAAGCTTAAT CTGTAAACCA
TTTTGCATTG GCTGGCTTGC TTAGGTTCTC TGCCTGGCCT TCTATGGTCA AATTTTACAA TCACAGGACG TCAAGCTTTT
CTCAGCTCAA GCATCACCTG TTTGCTTTGG GAACTCGTGC GTGAATGATC TTAAATACTG TGACCACAGA ATGATGACAT
ATTATTTGTT GTTGGGGTTC 

Locus: Os03g0851300

Loading...

Locus: Os03g0851300

Loading...