Os03t0851300-03

Locus

Os03g0851300

Description

Winged helix repressor DNA-binding domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RPN5

CGSNL Gene Name

19S REGULATORY PARTICLE NON-ATPASE SUBUNIT 5

Oryzabase Gene Symbol Synonym(s)

OsRpn5, Rpn5

Oryzabase Gene Name Synonym(s)

19S regulatory particle non-ATPase subunit 5, RP non-ATPase 5

Transcript Evidence

AK104846 (DDBJ, Best hit)

Protein Evidence

B3TM04 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Proteasome component (PCI) domain (IPR000717)

Winged helix-turn-helix transcription repressor DNA-binding (IPR011991)

Full-length cDNA

001-042-H04 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0851300-03)

RiceXPro (AK104846)

Others

Oryzabase (20565)

KEGG (Os03t0851300-03)

Transcript

1690 bp

>Os03t0851300-03 Winged helix repressor DNA-binding domain containing protein.
TCTTCTTCCTCTCCCGCAAGCAAAGCGCACGCCGCCTTTGCCTTAGATCTCCTCGACTCC
GCCGCCGCCGCCGGCGCCTCCCCACGGTCCCTCCCTCGCCATGGAGGGTAACAGTACCAA
CCTCGATGCGGCGATAGAGTCGCTCCTCAACGTGGAGAAGCAGATGAGGCTGGCCGGCGA
TGTCGCCGGCACGAGGAAGGCCGCCATCGACATCGTCGAGCTCTGCTACAAGGCCGGCGC
CTGGAAGACGCTCAACGATCAGATCGTGGTCCTCTCCAAGAGGAGGGGCCAGCTTAAGCA
GGCTATCACTGCCATGGTTCAGAAAGCAATGGAGTACATTGACTTAACGCCAGACATGGA
CACACGTATTGAGCTAATCAAGACGTTGAGCAGTGTATCTGCTGGAAAAATATATGTGGA
GATAGAGAGAGCAAGATTGATCAAAAGACTTGCAAAAATCAAAGAGGAGCAGGGACAGAT
TGATGAGGCTGCTGATTTAATGCAAGAAGTTGCTGTTGAAACATTTGGCTCCATGGCAAA
GACAGAAAAGATTGCATTCATTCTAGAGCAGGTCCGGCTGTGCTTGGATCGTCAAGATTA
TGTACGCGCACAGATTTTATCCAGGAAAATCAGTCCTAGGGTATTTGATGCAGACCCGTC
AAAGGAAAAAAAGAAACCGAAAGAAGGTGATAATATTGTTCAGGAAGCCCCAGCAGAGAT
ACCTTCCCTCCTGGAACTGAAGCGCATCTACTATGAACTGATGATTCGCTATTACTCGCA
CAACAATGATTACCTGGAAATCTGCCGTTGCTACAAGTCGATTTATGAAATTCCATCAAT
AAAAGAGGATCCATCAAAGTGGATACCGGTTCTTAGAAAGATCTGTTGGTATTTGGTGTT
GGCGCCTCATGATCCGATGCAATCAAGCCTTCTCAATGCCACACTCGAAGACAAAAATCT
CTCCGAGATACCAAATTTCCGGTTACTGCTGAAGCAACTTGTAACCATGGAGGTGATTCA
GTGGACAAGCTTGTGGGAATTCTTTAAAGATGAATATGCGAATGAGAAGAATTTTCTCGG
AGGAGCTTTGGGTGACAAAGCTGCAGAGGATCTGAAATTGAGGATCATTGAACATAATAT
CTTGGTTGTTTCGAAGTACTATTCAAGGATTACCCTGAAGAGGCTCGCAGATCTTCTTTG
CTTGAGCTTGCAGGAGGCAGAGAAACACCTTTCGGACATGGTAAACTCAAAGTCGCTGAT
TGCGAAGATTGACAGGCCAATGGGTGTTGTATGCTTCCGCACAGCACAAGACAGTAATGG
TATACTCAATTCCTGGGCGGCGAACCTCGAGAAACTCCTCGATCTTGTTGAGAAGAGCTG
TCACCAAATACACAAGGAGACGATGATCCATAAGGCGGTGTTGAAAGCTTAATCTGTAAA
CCATTTTGCATTGGCTGGCTTGCTTAGGTTCTCTGCCTGGCCTTCTATGGTCAAATTTTA
CAATCACAGGACGTCAAGCTTTTCTCAGCTCAAGCATCACCTGTTTGCTTTGGGAACTCG
TGCGTGAATGATCTTAAATACTGTGACCACAGAATGATGACATATTATTTGTTGTTGGGG
TTCAATCGCTGTCCTCCAATTTGCTTAACATGTGTATCTTCCCGAATATTATTTGAATTC
TAGATTATTC

CDS

1332 bp

>Os03t0851300-03 Winged helix repressor DNA-binding domain containing protein.
ATGGAGGGTAACAGTACCAACCTCGATGCGGCGATAGAGTCGCTCCTCAACGTGGAGAAG
CAGATGAGGCTGGCCGGCGATGTCGCCGGCACGAGGAAGGCCGCCATCGACATCGTCGAG
CTCTGCTACAAGGCCGGCGCCTGGAAGACGCTCAACGATCAGATCGTGGTCCTCTCCAAG
AGGAGGGGCCAGCTTAAGCAGGCTATCACTGCCATGGTTCAGAAAGCAATGGAGTACATT
GACTTAACGCCAGACATGGACACACGTATTGAGCTAATCAAGACGTTGAGCAGTGTATCT
GCTGGAAAAATATATGTGGAGATAGAGAGAGCAAGATTGATCAAAAGACTTGCAAAAATC
AAAGAGGAGCAGGGACAGATTGATGAGGCTGCTGATTTAATGCAAGAAGTTGCTGTTGAA
ACATTTGGCTCCATGGCAAAGACAGAAAAGATTGCATTCATTCTAGAGCAGGTCCGGCTG
TGCTTGGATCGTCAAGATTATGTACGCGCACAGATTTTATCCAGGAAAATCAGTCCTAGG
GTATTTGATGCAGACCCGTCAAAGGAAAAAAAGAAACCGAAAGAAGGTGATAATATTGTT
CAGGAAGCCCCAGCAGAGATACCTTCCCTCCTGGAACTGAAGCGCATCTACTATGAACTG
ATGATTCGCTATTACTCGCACAACAATGATTACCTGGAAATCTGCCGTTGCTACAAGTCG
ATTTATGAAATTCCATCAATAAAAGAGGATCCATCAAAGTGGATACCGGTTCTTAGAAAG
ATCTGTTGGTATTTGGTGTTGGCGCCTCATGATCCGATGCAATCAAGCCTTCTCAATGCC
ACACTCGAAGACAAAAATCTCTCCGAGATACCAAATTTCCGGTTACTGCTGAAGCAACTT
GTAACCATGGAGGTGATTCAGTGGACAAGCTTGTGGGAATTCTTTAAAGATGAATATGCG
AATGAGAAGAATTTTCTCGGAGGAGCTTTGGGTGACAAAGCTGCAGAGGATCTGAAATTG
AGGATCATTGAACATAATATCTTGGTTGTTTCGAAGTACTATTCAAGGATTACCCTGAAG
AGGCTCGCAGATCTTCTTTGCTTGAGCTTGCAGGAGGCAGAGAAACACCTTTCGGACATG
GTAAACTCAAAGTCGCTGATTGCGAAGATTGACAGGCCAATGGGTGTTGTATGCTTCCGC
ACAGCACAAGACAGTAATGGTATACTCAATTCCTGGGCGGCGAACCTCGAGAAACTCCTC
GATCTTGTTGAGAAGAGCTGTCACCAAATACACAAGGAGACGATGATCCATAAGGCGGTG
TTGAAAGCTTAA

Protein

444 aa

>Os03t0851300-03 Winged helix repressor DNA-binding domain containing protein.
MEGNSTNLDAAIESLLNVEKQMRLAGDVAGTRKAAIDIVELCYKAGAWKTLNDQIVVLSK
RRGQLKQAITAMVQKAMEYIDLTPDMDTRIELIKTLSSVSAGKIYVEIERARLIKRLAKI
KEEQGQIDEAADLMQEVAVETFGSMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPR
VFDADPSKEKKKPKEGDNIVQEAPAEIPSLLELKRIYYELMIRYYSHNNDYLEICRCYKS
IYEIPSIKEDPSKWIPVLRKICWYLVLAPHDPMQSSLLNATLEDKNLSEIPNFRLLLKQL
VTMEVIQWTSLWEFFKDEYANEKNFLGGALGDKAAEDLKLRIIEHNILVVSKYYSRITLK
RLADLLCLSLQEAEKHLSDMVNSKSLIAKIDRPMGVVCFRTAQDSNGILNSWAANLEKLL
DLVEKSCHQIHKETMIHKAVLKA*

5'UTR

chr03:35837840..35837939 (- strand) : 100 bp

CDS

chr03:35837837..35837839 (- strand) : 3 bp

chr03:35837466..35837663 (- strand) : 198 bp

chr03:35836639..35836746 (- strand) : 108 bp

chr03:35836445..35836549 (- strand) : 105 bp

chr03:35836285..35836341 (- strand) : 57 bp

chr03:35836008..35836204 (- strand) : 197 bp

chr03:35835302..35835401 (- strand) : 100 bp

chr03:35835094..35835206 (- strand) : 113 bp

chr03:35834853..35835006 (- strand) : 154 bp

chr03:35834687..35834764 (- strand) : 78 bp

chr03:35834374..35834592 (- strand) : 219 bp

3'UTR

chr03:35834116..35834373 (- strand) : 258 bp

FASTA

>Os03t0851300-03 class=Sequence position=chr03:35834116..35837939 (- strand)
TCTTCTTCCT CTCCCGCAAG CAAAGCGCAC GCCGCCTTTG CCTTAGATCT CCTCGACTCC GCCGCCGCCG CCGGCGCCTC
CCCACGGTCC CTCCCTCGCC ATGGTGAGCT CACCTCCCTC CTCCCCTCCC CCACCCCGAC CCTCCGCCCG CCTCTCCGGG
GTTTTGGCCT TCCCGCCCGC CCCGCCGCGG CCCGCACTTC TCATCTAGGG TTTCGATCTC TTGCGGGTTG ATCTGATGCC
TTGCAATCTG ACCCTGTTTC TTGTGGACCG ATGCAGGAGG GTAACAGTAC CAACCTCGAT GCGGCGATAG AGTCGCTCCT
CAACGTGGAG AAGCAGATGA GGCTGGCCGG CGATGTCGCC GGCACGAGGA AGGCCGCCAT CGACATCGTC GAGCTCTGCT
ACAAGGCCGG CGCCTGGAAG ACGCTCAACG ATCAGATCGT GGTCCTCTCC AAGAGGAGGG GCCAGCTTAA GCAGGTCAAG
CTCTCGTCCT CTCCTATCTT TGGACTTCGT TTAGTAGTTC TAGTTGAATT ACTAGCTGTA TTTAGCTATC TAACTGATAT
CTTCAAAGTT ATACTCTACT GACTAGAGGC ACATGCAAAC CCCAAAGTTT CCGAGGAGCA CATGTAATTG AGGCTAACAT
AGCATACCCA CCTGCTATTA TGTTGTCACT CTGAATCACC AGCCATTGAT TTTATTTTTG TAATCTTGGT ATGAACTTAG
AGTTATTCTA AGTTCTAGTG ATCTTAAATA GATTACACAA TTCAAATTAT CAACGCTCAC TGAAAGACAA TAGTCATATT
TTGCTCGATG TAATTGGATA TATGCCCTTA TTTCTAAGGG ATACTGGTGG TAGGGAAGGC ATGCCATAGT GTTGTGTAAG
ATTACTCTTT TCTTTGCAAA GCATTATGTG TTTAGGTTGA GTTTCAACTA ATGTTTTGTT GAGTGCTAAT CGAGTGCATT
GTATATTTCA CTTCGAAACA ATATTTGCAT GCATTTTTCT CCCCCCAAAA TTTCAGCATT GTCTCTCCAT ATCCCATACT
TAGGTCTTCC TGAAATATCC AGTTATTATT TACAAGTTGA ACAATATTTC ATAAATCATG CCTGTTTATG TATGCAATAC
TATTGCTGCT GCATTATAAC TTGGTTATGC ACATGTGGCA TGTCTCAACT CTTCTAATTC TTTATTTTTA CAGGCTATCA
CTGCCATGGT TCAGAAAGCA ATGGAGTACA TTGACTTAAC GCCAGACATG GACACACGTA TTGAGCTAAT CAAGACGTTG
AGCAGTGTAT CTGCTGGAAA AGTGAGAATC ATGGCTACTC AAATATTGCT TACCTATAAG ATTTAATGCC CTTTCATGTG
TGTAATCTCA CTGATATGCA TCAACTGTAG ATATATGTGG AGATAGAGAG AGCAAGATTG ATCAAAAGAC TTGCAAAAAT
CAAAGAGGAG CAGGGACAGA TTGATGAGGC TGCTGATTTA ATGCAAGAAG TTGCTGTAAG TTCAAGCTGC ACTATAATCA
TGGCACACAG TTACATCTAC TATAACCACC ATAGTGTTGT CTTCGCATCT ACATAATGTC TAACAAGTTC ATCCTCAGGT
TGAAACATTT GGCTCCATGG CAAAGACAGA AAAGATTGCA TTCATTCTAG AGCAGGTATG AAGAAATACA GTAATAAAGC
TTGAAATTGT TACAAAAGCC TGGGTTCTGG AATCTTACTG TAATCATGAT CACAGGTCCG GCTGTGCTTG GATCGTCAAG
ATTATGTACG CGCACAGATT TTATCCAGGA AAATCAGTCC TAGGGTATTT GATGCAGACC CGTCAAAGGA AAAAAAGAAA
CCGAAAGAAG GTGATAATAT TGTTCAGGAA GCCCCAGCAG AGATACCTTC CCTCCTGGAA CTGAAGCGCA TCTACTATGA
ACTGATGATT CGGTATGTCT TCCTGCTCAG TGAGACTAAT TCATCATGAG TTCATGTCGC TTCTAGTAAT GTTGGTTGAA
GTTAATGCta ccccctcagg tcgcaaaata tagctacctt tagctatgaa tatggacaag ttcagattca cagataaagg
tagctatatt ttgggatgga gggagtTCTA TTTTGTTCAG CAAAGAATTG CTTTCGACTG TTTGATTCAT GATCTAATAC
ATAGTGATAG TTAACTATTT AGAGTTTTCT GCTAAGTCAA TCTAATGCTT GGTTGATTAA ACAAAAGAAC TAATGTGGTG
TCATATCCCT TACTGCTATT AGACAATTGT TTATGTAGCT TGTATTTTAT TTACTCAGGA AATATCAATT CCTCTTCTGC
GGTTACCTGT CAAATATGTT TGCGATTGTT TACCATCATC ATGTTATGGT TACTGCTTGA ATGCCTTATT TGTATCCATC
AACCTTTTTT TATGCTACAA TTATGAATAC TGTATTTGTG CTGTTTGAAT TCTCGCTAAC TGATTTTATA ACCTGCTAAG
AGTATATATT TTTTTCTATA TATGTGGTGA AACATGATTT CTGTTTGTCT CTATTCAGCT ATTACTCGCA CAACAATGAT
TACCTGGAAA TCTGCCGTTG CTACAAGTCG ATTTATGAAA TTCCATCAAT AAAAGAGGAT CCATCAAAGT GGATACCGGT
AAAGCTCTCT CATTCGCAAG TCTTACTTGG TGTGGTGTGT GCGCATACTC ACTCACGCTA TAATGGTTAT CTGACTGCCT
GAATTCGCTT TAGGTTCTTA GAAAGATCTG TTGGTATTTG GTGTTGGCGC CTCATGATCC GATGCAATCA AGCCTTCTCA
ATGCCACACT CGAAGACAAA AATCTCTCCG AGATACCAAA TTTCCGGTAC GTTATGTTGC TTTCAGGATT ACAAATTATC
ATGGTTTTTA ATGTTCTTTC TAATTCCTAC TTTTGCTGTT TGGATGGGAA TAGGTTACTG CTGAAGCAAC TTGTAACCAT
GGAGGTGATT CAGTGGACAA GCTTGTGGGA ATTCTTTAAA GATGAATATG CGAATGAGAA GAATTTTCTC GGAGGAGCTT
TGGGTGACAA AGCTGCAGAG GATCTGAAAT TGAGGATCAT TGAACATGTA TTGCTTACTT GACTTTATCG TATTTCTCTT
TTGGTTCCTT GCTTTGTATT TGTCAGTTGA TTTCCAGTTC TTTGCTTTTG TTCAGAATAT CTTGGTTGTT TCGAAGTACT
ATTCAAGGAT TACCCTGAAG AGGCTCGCAG ATCTTCTTTG CTTGAGCTTG CAGGTTTGTG TTCCCAGCCT TCCTAGCATC
ACTTGTATTC CTCTTGTTAC TTTGTAGCCT ACCAAGATCT AACATGCCCC ACATTTTTCT CATTCAGGAG GCAGAGAAAC
ACCTTTCGGA CATGGTAAAC TCAAAGTCGC TGATTGCGAA GATTGACAGG CCAATGGGTG TTGTATGCTT CCGCACAGCA
CAAGACAGTA ATGGTATACT CAATTCCTGG GCGGCGAACC TCGAGAAACT CCTCGATCTT GTTGAGAAGA GCTGTCACCA
AATACACAAG GAGACGATGA TCCATAAGGC GGTGTTGAAA GCTTAATCTG TAAACCATTT TGCATTGGCT GGCTTGCTTA
GGTTCTCTGC CTGGCCTTCT ATGGTCAAAT TTTACAATCA CAGGACGTCA AGCTTTTCTC AGCTCAAGCA TCACCTGTTT
GCTTTGGGAA CTCGTGCGTG AATGATCTTA AATACTGTGA CCACAGAATG ATGACATATT ATTTGTTGTT GGGGTTCAAT
CGCTGTCCTC CAATTTGCTT AACATGTGTA TCTTCCCGAA TATTATTTGA ATTCTAGATT ATTC

Locus: Os03g0851300

Loading...

Locus: Os03g0851300

Loading...