Os03t0851300-04

Locus

Os03g0851300

Description

Similar to 26S proteasome subunit RPN5b.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RPN5

CGSNL Gene Name

19S REGULATORY PARTICLE NON-ATPASE SUBUNIT 5

Oryzabase Gene Symbol Synonym(s)

OsRpn5, Rpn5

Oryzabase Gene Name Synonym(s)

19S regulatory particle non-ATPase subunit 5, RP non-ATPase 5

Transcript Evidence

AK105457 (DDBJ, Best hit)

Protein Evidence

B3TM04 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-125-E03 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0851300-04)

Others

Oryzabase (20565)

Transcript

655 bp

>Os03t0851300-04 Similar to 26S proteasome subunit RPN5b.
CTCCCGCAAGCAAAGCGCACGCCGCCTTTGCCTTAGATCTCCTCGACTCCGCCGCCGCCG
CCGGCGCCTCCCCACGGTCCCTCCCTCGCCATGGAGGGTAACAGTACCAACCTCGATGCG
GCGATAGAGTCGCTCCTCAACGTGGAGAAGCAGATGAGGCTGGCCGGCGATGTCGCCGGC
ACGAGGAAGGCCGCCATCGACATCGTCGAGCTCTGCTACAAGGCCGGCGCCTGGAAGACG
CTCAACGATCAGATCGTGGTCCTCTCCAAGAGGAGGGGCCAGCTTAAGCAGGCTATCACT
GCCATGGTTCAGAAAGCAATGGAGTACATTGACTTAACGCCAGACATGGACACACGTATT
GAGCTAATCAAGACGTTGAGCAGTGTATCTGCTGGAAAAATATATGTGGAGATAGAGAGA
GCAAGATTGATCAAAAGACTTGCAAAAATCAAAGAGGAGCAGGGACAGATTGATGAGGCT
GCTGATTTAATGCAAGAAGTTGCTGTTGAAACATTTGGCTCCATGGCAAAGACAGAAAAG
ATTGCATTCATTCTAGAGCAGGTCCGGCTGTGCTTGGATCGTCAAGATTATGTACGCGCA
CAGATTTTATCCAGGAAAATCAGTCCTAGGGTATTTGATGCAGACCCGTCAAAGG

CDS

565 bp

>Os03t0851300-04 Similar to 26S proteasome subunit RPN5b.
ATGGAGGGTAACAGTACCAACCTCGATGCGGCGATAGAGTCGCTCCTCAACGTGGAGAAG
CAGATGAGGCTGGCCGGCGATGTCGCCGGCACGAGGAAGGCCGCCATCGACATCGTCGAG
CTCTGCTACAAGGCCGGCGCCTGGAAGACGCTCAACGATCAGATCGTGGTCCTCTCCAAG
AGGAGGGGCCAGCTTAAGCAGGCTATCACTGCCATGGTTCAGAAAGCAATGGAGTACATT
GACTTAACGCCAGACATGGACACACGTATTGAGCTAATCAAGACGTTGAGCAGTGTATCT
GCTGGAAAAATATATGTGGAGATAGAGAGAGCAAGATTGATCAAAAGACTTGCAAAAATC
AAAGAGGAGCAGGGACAGATTGATGAGGCTGCTGATTTAATGCAAGAAGTTGCTGTTGAA
ACATTTGGCTCCATGGCAAAGACAGAAAAGATTGCATTCATTCTAGAGCAGGTCCGGCTG
TGCTTGGATCGTCAAGATTATGTACGCGCACAGATTTTATCCAGGAAAATCAGTCCTAGG
GTATTTGATGCAGACCCGTCAAAGG

Protein

188 aa

>Os03t0851300-04 Similar to 26S proteasome subunit RPN5b.
MEGNSTNLDAAIESLLNVEKQMRLAGDVAGTRKAAIDIVELCYKAGAWKTLNDQIVVLSK
RRGQLKQAITAMVQKAMEYIDLTPDMDTRIELIKTLSSVSAGKIYVEIERARLIKRLAKI
KEEQGQIDEAADLMQEVAVETFGSMAKTEKIAFILEQVRLCLDRQDYVRAQILSRKISPR
VFDADPSK

5'UTR

chr03:35837840..35837929 (- strand) : 90 bp

CDS

chr03:35837837..35837839 (- strand) : 3 bp

chr03:35837466..35837663 (- strand) : 198 bp

chr03:35836639..35836746 (- strand) : 108 bp

chr03:35836445..35836549 (- strand) : 105 bp

chr03:35836285..35836341 (- strand) : 57 bp

chr03:35836111..35836204 (- strand) : 94 bp

FASTA

>Os03t0851300-04 class=Sequence position=chr03:35836111..35837929 (- strand)
CTCCCGCAAG CAAAGCGCAC GCCGCCTTTG CCTTAGATCT CCTCGACTCC GCCGCCGCCG CCGGCGCCTC CCCACGGTCC
CTCCCTCGCC ATGGTGAGCT CACCTCCCTC CTCCCCTCCC CCACCCCGAC CCTCCGCCCG CCTCTCCGGG GTTTTGGCCT
TCCCGCCCGC CCCGCCGCGG CCCGCACTTC TCATCTAGGG TTTCGATCTC TTGCGGGTTG ATCTGATGCC TTGCAATCTG
ACCCTGTTTC TTGTGGACCG ATGCAGGAGG GTAACAGTAC CAACCTCGAT GCGGCGATAG AGTCGCTCCT CAACGTGGAG
AAGCAGATGA GGCTGGCCGG CGATGTCGCC GGCACGAGGA AGGCCGCCAT CGACATCGTC GAGCTCTGCT ACAAGGCCGG
CGCCTGGAAG ACGCTCAACG ATCAGATCGT GGTCCTCTCC AAGAGGAGGG GCCAGCTTAA GCAGGTCAAG CTCTCGTCCT
CTCCTATCTT TGGACTTCGT TTAGTAGTTC TAGTTGAATT ACTAGCTGTA TTTAGCTATC TAACTGATAT CTTCAAAGTT
ATACTCTACT GACTAGAGGC ACATGCAAAC CCCAAAGTTT CCGAGGAGCA CATGTAATTG AGGCTAACAT AGCATACCCA
CCTGCTATTA TGTTGTCACT CTGAATCACC AGCCATTGAT TTTATTTTTG TAATCTTGGT ATGAACTTAG AGTTATTCTA
AGTTCTAGTG ATCTTAAATA GATTACACAA TTCAAATTAT CAACGCTCAC TGAAAGACAA TAGTCATATT TTGCTCGATG
TAATTGGATA TATGCCCTTA TTTCTAAGGG ATACTGGTGG TAGGGAAGGC ATGCCATAGT GTTGTGTAAG ATTACTCTTT
TCTTTGCAAA GCATTATGTG TTTAGGTTGA GTTTCAACTA ATGTTTTGTT GAGTGCTAAT CGAGTGCATT GTATATTTCA
CTTCGAAACA ATATTTGCAT GCATTTTTCT CCCCCCAAAA TTTCAGCATT GTCTCTCCAT ATCCCATACT TAGGTCTTCC
TGAAATATCC AGTTATTATT TACAAGTTGA ACAATATTTC ATAAATCATG CCTGTTTATG TATGCAATAC TATTGCTGCT
GCATTATAAC TTGGTTATGC ACATGTGGCA TGTCTCAACT CTTCTAATTC TTTATTTTTA CAGGCTATCA CTGCCATGGT
TCAGAAAGCA ATGGAGTACA TTGACTTAAC GCCAGACATG GACACACGTA TTGAGCTAAT CAAGACGTTG AGCAGTGTAT
CTGCTGGAAA AGTGAGAATC ATGGCTACTC AAATATTGCT TACCTATAAG ATTTAATGCC CTTTCATGTG TGTAATCTCA
CTGATATGCA TCAACTGTAG ATATATGTGG AGATAGAGAG AGCAAGATTG ATCAAAAGAC TTGCAAAAAT CAAAGAGGAG
CAGGGACAGA TTGATGAGGC TGCTGATTTA ATGCAAGAAG TTGCTGTAAG TTCAAGCTGC ACTATAATCA TGGCACACAG
TTACATCTAC TATAACCACC ATAGTGTTGT CTTCGCATCT ACATAATGTC TAACAAGTTC ATCCTCAGGT TGAAACATTT
GGCTCCATGG CAAAGACAGA AAAGATTGCA TTCATTCTAG AGCAGGTATG AAGAAATACA GTAATAAAGC TTGAAATTGT
TACAAAAGCC TGGGTTCTGG AATCTTACTG TAATCATGAT CACAGGTCCG GCTGTGCTTG GATCGTCAAG ATTATGTACG
CGCACAGATT TTATCCAGGA AAATCAGTCC TAGGGTATTT GATGCAGACC CGTCAAAGG

Locus: Os03g0851300

Loading...

Locus: Os03g0851300

Loading...