Os03t0851700-01

Locus

Os03g0851700

Description

Xb25 paralog

RAP-DB Gene Symbol Synonym(s)

Xbos251, XBOS251

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Xbos251, XBOS251

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK068082

Protein Evidence

Q851Y1

Literature

PMID: 23206229

Note

Manual Curation

August 3, 2020

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Ankyrin repeat-containing domain superfamily (IPR036770)

STI1 domain (IPR041243)

Ankyrin repeat-containing domain (IPR020683)

Ankyrin repeat (IPR002110)

Full-length cDNA

J013130D01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0851700-01)

RiceXPro (AK068082)

Others

Oryzabase (21677)

KEGG (Os03t0851700-01)

Transcript

1359 bp

>Os03t0851700-01 Xb25 paralog
ACTGCCTGAACCAAGAACACTGCCCTCCTCCACACGACATGGCTTCTCAAGAAGAGAAGA
CGAGCGTCAAGTCGGAGGAGGCCTCGTCGGCGGCGGAGGAGCAGCCACCTCAAGCTGCAG
CTCCGCCGCCGCGCAGGGGTGTGCCGCCGGCCAACCCCTTCGACTTCTCAACCATGATGA
ACTTGCTCAATGATCCGAGCATAAAGGAGATGGCGGAGCAGATCGCCAAGGACCCGGCGT
TCACGGAGATGGCGGAGCAGCTGCAGAAGACGGTGCAGTCGCCGCCGGCGCGGGGGGCGG
CGCAGGAGGCTGCGGCGGCGGCGGCGCCGGCGCTGGACCCGAGCAAGTACGTGTCGACGA
TGCAGCAGCTGATGCAGAACCCGCAGTTCGTGGCGATGGCGGAGCGGCTGGGCAGCGCGC
TGATGCAGGACCCGGCCATGTCGTCCATGCTTGGCGGCCTCACCAACCCCGCCCACAAGG
AGCAGCTCGAGGCCCGCATCGCCCGCATGAAGGACGACCCCTCCCTCAAGCCCATCCTCG
ACGAGATCGAGAACGGCGGCCCCGCCGCCATGATGAAGTATTGGAACGACCCTGAAGCGC
TGCAGAAGTTCGGGAGGGCGATGGGCGTCGGCCCGTCGGGCGAGGGCGCGGCGGCGGCCG
GCGGCGAGCACGAGGAGGCGGAGGAAGAGGGCGGGGAGGAGGGCGAGTACGAGGACGAGT
CCGTCATCCACCACACTGCCAGCGTCGGCGATGTCGAGGGCCTGAAGAAAGCATTGGAGG
AAGGCGTGGACAAGGACGAGGAGGATTCGGAAGGGAGGAGAGGCCTGCATTTCGCTTGCG
GCTATGGCGAGCTGAAATGCGCGCAGGTTCTCCTGGAGGCCGGCGCGGCCGTGGACGCGG
TGGACAAGAACAAGAACACGGCGCTGCACTACGCCGCCGGCTACGGCCGCAAGGACTGCG
TCGCCCTCCTGCTCGACCACGGCGCCGCCGTGACGGTGCAGAACCTGGACGGGAAGACGG
CCATCGACGTGGCGAAACTCAACAACCAGGAGGAAGTCCTCAAGCTGCTCGAGAAGCACG
CCTTCGTATAGAATGAAACAATCGAGGCCAGGCCAGGCCAGGCCAGCCACACTCCTCTCT
CTCAATTCAGAGACAAATGCTGCATTTCTGCTCTGCATATGCTCCTGTTCATCCGCAAAT
GAGTACCTGTATGCTTCTGTATGTATCGAAGAGTGCACTAGATTATTTTTTATTTCACTT
GGGAGCAAGGTTAAGGTGAGATTGGATTGCTATTCTATTCATCCTTCCAGAGTTTTGTTT
AATGAATAAGGAAGAAAAGTAAATTTCATTTCAGTGTTT

CDS

1053 bp

>Os03t0851700-01 Xb25 paralog
ATGGCTTCTCAAGAAGAGAAGACGAGCGTCAAGTCGGAGGAGGCCTCGTCGGCGGCGGAG
GAGCAGCCACCTCAAGCTGCAGCTCCGCCGCCGCGCAGGGGTGTGCCGCCGGCCAACCCC
TTCGACTTCTCAACCATGATGAACTTGCTCAATGATCCGAGCATAAAGGAGATGGCGGAG
CAGATCGCCAAGGACCCGGCGTTCACGGAGATGGCGGAGCAGCTGCAGAAGACGGTGCAG
TCGCCGCCGGCGCGGGGGGCGGCGCAGGAGGCTGCGGCGGCGGCGGCGCCGGCGCTGGAC
CCGAGCAAGTACGTGTCGACGATGCAGCAGCTGATGCAGAACCCGCAGTTCGTGGCGATG
GCGGAGCGGCTGGGCAGCGCGCTGATGCAGGACCCGGCCATGTCGTCCATGCTTGGCGGC
CTCACCAACCCCGCCCACAAGGAGCAGCTCGAGGCCCGCATCGCCCGCATGAAGGACGAC
CCCTCCCTCAAGCCCATCCTCGACGAGATCGAGAACGGCGGCCCCGCCGCCATGATGAAG
TATTGGAACGACCCTGAAGCGCTGCAGAAGTTCGGGAGGGCGATGGGCGTCGGCCCGTCG
GGCGAGGGCGCGGCGGCGGCCGGCGGCGAGCACGAGGAGGCGGAGGAAGAGGGCGGGGAG
GAGGGCGAGTACGAGGACGAGTCCGTCATCCACCACACTGCCAGCGTCGGCGATGTCGAG
GGCCTGAAGAAAGCATTGGAGGAAGGCGTGGACAAGGACGAGGAGGATTCGGAAGGGAGG
AGAGGCCTGCATTTCGCTTGCGGCTATGGCGAGCTGAAATGCGCGCAGGTTCTCCTGGAG
GCCGGCGCGGCCGTGGACGCGGTGGACAAGAACAAGAACACGGCGCTGCACTACGCCGCC
GGCTACGGCCGCAAGGACTGCGTCGCCCTCCTGCTCGACCACGGCGCCGCCGTGACGGTG
CAGAACCTGGACGGGAAGACGGCCATCGACGTGGCGAAACTCAACAACCAGGAGGAAGTC
CTCAAGCTGCTCGAGAAGCACGCCTTCGTATAG

Protein

350 aa

>Os03t0851700-01 Xb25 paralog
MASQEEKTSVKSEEASSAAEEQPPQAAAPPPRRGVPPANPFDFSTMMNLLNDPSIKEMAE
QIAKDPAFTEMAEQLQKTVQSPPARGAAQEAAAAAAPALDPSKYVSTMQQLMQNPQFVAM
AERLGSALMQDPAMSSMLGGLTNPAHKEQLEARIARMKDDPSLKPILDEIENGGPAAMMK
YWNDPEALQKFGRAMGVGPSGEGAAAAGGEHEEAEEEGGEEGEYEDESVIHHTASVGDVE
GLKKALEEGVDKDEEDSEGRRGLHFACGYGELKCAQVLLEAGAAVDAVDKNKNTALHYAA
GYGRKDCVALLLDHGAAVTVQNLDGKTAIDVAKLNNQEEVLKLLEKHAFV*

5'UTR

chr03:35861615..35861652 (+ strand) : 38 bp

CDS

chr03:35861653..35861665 (+ strand) : 13 bp

chr03:35861781..35861920 (+ strand) : 140 bp

chr03:35862254..35862639 (+ strand) : 386 bp

chr03:35862745..35862925 (+ strand) : 181 bp

chr03:35863313..35863405 (+ strand) : 93 bp

chr03:35863482..35863621 (+ strand) : 140 bp

chr03:35863721..35863820 (+ strand) : 100 bp

3'UTR

chr03:35863821..35864088 (+ strand) : 268 bp

FASTA

>Os03t0851700-01 class=Sequence position=chr03:35861615..35864088 (+ strand)
ACTGCCTGAA CCAAGAACAC TGCCCTCCTC CACACGACAT GGCTTCTCAA GGTCAAAAGA ACTGATTTGC TGTTTATTTC
TTCAATTCTT TCTTTCTTGT TTGATTTGCT CCGGCTCAAT TCTTTCTGAT ACTGATAAGA GACGACATGA GTAATTGTGT
GCGCAGAAGA GAAGACGAGC GTCAAGTCGG AGGAGGCCTC GTCGGCGGCG GAGGAGCAGC CACCTCAAGC TGCAGCTCCG
CCGCCGCGCA GGGGTGTGCC GCCGGCCAAC CCCTTCGACT TCTCAACCAT GATGAACTTG CTCAATGTAA GCTTACCTCG
CTGCCGACTT ATTTCACTAA TTGCCTACTC GTTTCAGCGT AATTTCCTCA ACTATATTTT GGGTATAATC TCCTCTTGAA
CCTAAGTTAT CCGATAATTA ATTAATTAGC AGCTACCTGT TCAAGATTGA GTTAATTAAG CAACTCACTA TATAACCAAC
CAGGTGTTGT TGCTTATTAG CTGAGATGGA AGCTGGATTG ATTAATTATA CAGTTCATGC AATTACTAGT AATAATTAGT
GAGTCCATTG ATGAAATGAT GAGCAGAAAA AATAATTAGA TATGAATAAT CTGCATGGTA ATTTGTTTGT TTGGAGCAGG
ATCCGAGCAT AAAGGAGATG GCGGAGCAGA TCGCCAAGGA CCCGGCGTTC ACGGAGATGG CGGAGCAGCT GCAGAAGACG
GTGCAGTCGC CGCCGGCGCG GGGGGCGGCG CAGGAGGCTG CGGCGGCGGC GGCGCCGGCG CTGGACCCGA GCAAGTACGT
GTCGACGATG CAGCAGCTGA TGCAGAACCC GCAGTTCGTG GCGATGGCGG AGCGGCTGGG CAGCGCGCTG ATGCAGGACC
CGGCCATGTC GTCCATGCTT GGCGGCCTCA CCAACCCCGC CCACAAGGAG CAGCTCGAGG CCCGCATCGC CCGCATGAAG
GACGACCCCT CCCTCAAGCC CATCCTCGAC GAGATCGAGA ACGGCGGCCC CGCCGCCATG ATGAAGTAAG CATAGTTGCA
ATTGGCGCCA TGGCTGGTTG AGTTCATCGT CGTCGTCGTC GTCGATCTCG AAAGCAAATG AGCAATGGCA ATACTTGTTG
CTTCCTTCAG GTATTGGAAC GACCCTGAAG CGCTGCAGAA GTTCGGGAGG GCGATGGGCG TCGGCCCGTC GGGCGAGGGC
GCGGCGGCGG CCGGCGGCGA GCACGAGGAG GCGGAGGAAG AGGGCGGGGA GGAGGGCGAG TACGAGGACG AGTCCGTCAT
CCACCACACT GCCAGCGTCG GCGATGTCGA GGTCTCTAAA TCAATTCTCA CTTCTATTAC TGCCTACTCT CTCCTTTTCA
AGACAAGAtg gtcaaaatca aaccatttta aatttaacta aattatagac aaatatagta atatttataa tactaaatta
gtttttttct tgattattta tagagtaata tttacaatac aaaatcaata attgaatata ttctcataat aaatttgttt
aggattgaaa atgttattat ttttttctat aaacttgttt aaatctaaag ctgtttcact ttgaTTAAAT TTAAAACGTT
TTATAATCTG AAATCAGAGG GAGTACTAAT TATGCGCATT TGCTCAAGTA AAATCTGCAT CTTTTCCTTC ATCTTCAACA
CGCATTGGCA TCGTTCAGGG CCTGAAGAAA GCATTGGAGG AAGGCGTGGA CAAGGACGAG GAGGATTCGG AAGGGAGGAG
AGGCCTGCAT TTCGCTTGCG GCTATGGCGA GGTAAGCATC ATGCATGCAG TTCTCAGTGA ACATCTTGTT CAGTTATCTG
ATCGATTCGT TGCTTGTGTT TGCGCAGCTG AAATGCGCGC AGGTTCTCCT GGAGGCCGGC GCGGCCGTGG ACGCGGTGGA
CAAGAACAAG AACACGGCGC TGCACTACGC CGCCGGCTAC GGCCGCAAGG ACTGCGTCGC CCTCCTGCTC GACCACGGCG
CCGCCGTGTA AGTCCATCGC ATCTGCAATT CTGCATGCAT ATGCCCATGC CATCCATCAA TGGACATCTG ACTGAAACTA
ACCCGGTTTG GTTATGCAAT GTGCAGGACG GTGCAGAACC TGGACGGGAA GACGGCCATC GACGTGGCGA AACTCAACAA
CCAGGAGGAA GTCCTCAAGC TGCTCGAGAA GCACGCCTTC GTATAGAATG AAACAATCGA GGCCAGGCCA GGCCAGGCCA
GCCACACTCC TCTCTCTCAA TTCAGAGACA AATGCTGCAT TTCTGCTCTG CATATGCTCC TGTTCATCCG CAAATGAGTA
CCTGTATGCT TCTGTATGTA TCGAAGAGTG CACTAGATTA TTTTTTATTT CACTTGGGAG CAAGGTTAAG GTGAGATTGG
ATTGCTATTC TATTCATCCT TCCAGAGTTT TGTTTAATGA ATAAGGAAGA AAAGTAAATT TCATTTCAGT GTTT

Locus: Os03g0851700

Loading...

Locus: Os03g0851700

Loading...