Os03t0852800-00

Locus

Os03g0852800

Description

Similar to NPC4 (NONSPECIFIC PHOSPHOLIPASE C4); hydrolase, acting on ester bonds / phospholipase C.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NPC4

CGSNL Gene Name

NON-SPECIFIC PHOSPHOLIPASE C4

Oryzabase Gene Symbol Synonym(s)

OsNPC3, OsNPC4, NPC3

Oryzabase Gene Name Synonym(s)

Non-specific phospholipase C4

Transcript Evidence

ab initio prediction

Protein Evidence

NP_566206.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: hydrolase activity, acting on ester bonds (GO:0016788)

Functional domain (InterPro)

Phosphoesterase (IPR007312)

Expression Databases

TENOR (Os03t0852800-00)

Others

Oryzabase (21050)

Transcript

1272 bp

>Os03t0852800-00 Similar to NPC4 (NONSPECIFIC PHOSPHOLIPASE C4); hydrolase, acting on ester bonds / phospholipase C.
ATGGCCGGCTTCGCGCAGCAGGCGGAGAAGGAGAAGCCCGGCATGGCGGACACCGTCATG
AACGGCTTCCGGCCGGAGGCCGTGCCGGTGTACCGCGAGCTGGTGCGGCAGTTCGCCGTG
TGCGACCGCTGGTTCGCGTCCAACCCGGCGTCGACGCAGCCCAACCGGCTGTTCGTCCAC
TCAGCGACGTCGCACGGGCTCGTCAGCAACGACACCAAGCTGCTCGTCGCCGGCCTCCCG
CAGCGCACCATCTTTGACTCCCTCCACGACGCCGGCTTCTCCTTCGGCATCTACTACCAG
TACCCGCCGTCCACGCTCTTCTACCGGAGCTTGCGCCAGCTCAAGTACGCCGGCAACTTC
CACCCCTTCGACCTCGCGTTCCGGCGGCACTGCGCCGAGGGCAAGCTCCCCAACTACGTC
GTCGTCGAGCAGCGCTACTTCGACCTCAAGATGCTCCCCGGCAACGACGACCACCCCTCG
CACGACGTCTCCGAGGGCCAGCGATTCGTCAAGGAGGTGTACGAGGCGCTGCGTGGCGGG
CCGCAGTGGGAGGAGGCGCTCCTCGTCGTCACCTACGACGAGCACGGCGGCTTCTACGAC
CACGTCCCGACGCCGGTGGACGTGCCCAGCCCCGACGGCATCGTCAGCGCCGCGCCATTC
TTCTTCGAGTTCAACCGCCTCGGCGTCCGCGTCCCGGCGCTCTTCATCTCGCCGTGGATC
GAGCCGGGCACGGTGGTGCACCGGCCGTCGGGGCCGTACCCGACGTCGGAGTTCGAGCAC
TCCTCCATCCCGGCCACCGTGAAGAAGCTCTTCAACCTCAAGAGCTTCCTGACCAACCGC
GACGCCTGGGCGGGCACCTTCGACGTCGTCCTCACGCGCGACGCGCCGCGCACCGACTGC
CCCGCCACCCTGCCGGAGCCggtgaagatgaggccggcgacggaggcggcggagcaggcg
gcgctgacggagTTCCAGGAGGAGCTGGTGCAGCTGGGGGCGGTGCTCAACGGCGACCAC
GCCGACGAGGACGTGTACCCGCGCAAGCTGGTGGAGGGGATGACGGTGGCGGAGGCGGCC
AGCTACTGCAACGCCGCCTTCAAGGCATGGATGGACGAGTGCGACCGCTGCAGGAAGTGC
GGCGAGGACGGGTCCCACATCCCCACGGTGGTGAAGCCGCCGCCGCCGCCGTCGACGTCG
TCCTCAGGCTCTAGCTCCTTTGCTTCCAAGTTGCTGTCTTGCTTTGCGTGTGGTCGTCCT
AACAAGAATTAG

CDS

1272 bp

>Os03t0852800-00 Similar to NPC4 (NONSPECIFIC PHOSPHOLIPASE C4); hydrolase, acting on ester bonds / phospholipase C.
ATGGCCGGCTTCGCGCAGCAGGCGGAGAAGGAGAAGCCCGGCATGGCGGACACCGTCATG
AACGGCTTCCGGCCGGAGGCCGTGCCGGTGTACCGCGAGCTGGTGCGGCAGTTCGCCGTG
TGCGACCGCTGGTTCGCGTCCAACCCGGCGTCGACGCAGCCCAACCGGCTGTTCGTCCAC
TCAGCGACGTCGCACGGGCTCGTCAGCAACGACACCAAGCTGCTCGTCGCCGGCCTCCCG
CAGCGCACCATCTTTGACTCCCTCCACGACGCCGGCTTCTCCTTCGGCATCTACTACCAG
TACCCGCCGTCCACGCTCTTCTACCGGAGCTTGCGCCAGCTCAAGTACGCCGGCAACTTC
CACCCCTTCGACCTCGCGTTCCGGCGGCACTGCGCCGAGGGCAAGCTCCCCAACTACGTC
GTCGTCGAGCAGCGCTACTTCGACCTCAAGATGCTCCCCGGCAACGACGACCACCCCTCG
CACGACGTCTCCGAGGGCCAGCGATTCGTCAAGGAGGTGTACGAGGCGCTGCGTGGCGGG
CCGCAGTGGGAGGAGGCGCTCCTCGTCGTCACCTACGACGAGCACGGCGGCTTCTACGAC
CACGTCCCGACGCCGGTGGACGTGCCCAGCCCCGACGGCATCGTCAGCGCCGCGCCATTC
TTCTTCGAGTTCAACCGCCTCGGCGTCCGCGTCCCGGCGCTCTTCATCTCGCCGTGGATC
GAGCCGGGCACGGTGGTGCACCGGCCGTCGGGGCCGTACCCGACGTCGGAGTTCGAGCAC
TCCTCCATCCCGGCCACCGTGAAGAAGCTCTTCAACCTCAAGAGCTTCCTGACCAACCGC
GACGCCTGGGCGGGCACCTTCGACGTCGTCCTCACGCGCGACGCGCCGCGCACCGACTGC
CCCGCCACCCTGCCGGAGCCggtgaagatgaggccggcgacggaggcggcggagcaggcg
gcgctgacggagTTCCAGGAGGAGCTGGTGCAGCTGGGGGCGGTGCTCAACGGCGACCAC
GCCGACGAGGACGTGTACCCGCGCAAGCTGGTGGAGGGGATGACGGTGGCGGAGGCGGCC
AGCTACTGCAACGCCGCCTTCAAGGCATGGATGGACGAGTGCGACCGCTGCAGGAAGTGC
GGCGAGGACGGGTCCCACATCCCCACGGTGGTGAAGCCGCCGCCGCCGCCGTCGACGTCG
TCCTCAGGCTCTAGCTCCTTTGCTTCCAAGTTGCTGTCTTGCTTTGCGTGTGGTCGTCCT
AACAAGAATTAG

Protein

424 aa

>Os03t0852800-00 Similar to NPC4 (NONSPECIFIC PHOSPHOLIPASE C4); hydrolase, acting on ester bonds / phospholipase C.
MAGFAQQAEKEKPGMADTVMNGFRPEAVPVYRELVRQFAVCDRWFASNPASTQPNRLFVH
SATSHGLVSNDTKLLVAGLPQRTIFDSLHDAGFSFGIYYQYPPSTLFYRSLRQLKYAGNF
HPFDLAFRRHCAEGKLPNYVVVEQRYFDLKMLPGNDDHPSHDVSEGQRFVKEVYEALRGG
PQWEEALLVVTYDEHGGFYDHVPTPVDVPSPDGIVSAAPFFFEFNRLGVRVPALFISPWI
EPGTVVHRPSGPYPTSEFEHSSIPATVKKLFNLKSFLTNRDAWAGTFDVVLTRDAPRTDC
PATLPEPVKMRPATEAAEQAALTEFQEELVQLGAVLNGDHADEDVYPRKLVEGMTVAEAA
SYCNAAFKAWMDECDRCRKCGEDGSHIPTVVKPPPPPSTSSSGSSSFASKLLSCFACGRP
NKN*

CDS

chr03:35907129..35908400 (+ strand) : 1272 bp

FASTA

>Os03t0852800-00 class=Sequence position=chr03:35907129..35908400 (+ strand)
ATGGCCGGCT TCGCGCAGCA GGCGGAGAAG GAGAAGCCCG GCATGGCGGA CACCGTCATG AACGGCTTCC GGCCGGAGGC
CGTGCCGGTG TACCGCGAGC TGGTGCGGCA GTTCGCCGTG TGCGACCGCT GGTTCGCGTC CAACCCGGCG TCGACGCAGC
CCAACCGGCT GTTCGTCCAC TCAGCGACGT CGCACGGGCT CGTCAGCAAC GACACCAAGC TGCTCGTCGC CGGCCTCCCG
CAGCGCACCA TCTTTGACTC CCTCCACGAC GCCGGCTTCT CCTTCGGCAT CTACTACCAG TACCCGCCGT CCACGCTCTT
CTACCGGAGC TTGCGCCAGC TCAAGTACGC CGGCAACTTC CACCCCTTCG ACCTCGCGTT CCGGCGGCAC TGCGCCGAGG
GCAAGCTCCC CAACTACGTC GTCGTCGAGC AGCGCTACTT CGACCTCAAG ATGCTCCCCG GCAACGACGA CCACCCCTCG
CACGACGTCT CCGAGGGCCA GCGATTCGTC AAGGAGGTGT ACGAGGCGCT GCGTGGCGGG CCGCAGTGGG AGGAGGCGCT
CCTCGTCGTC ACCTACGACG AGCACGGCGG CTTCTACGAC CACGTCCCGA CGCCGGTGGA CGTGCCCAGC CCCGACGGCA
TCGTCAGCGC CGCGCCATTC TTCTTCGAGT TCAACCGCCT CGGCGTCCGC GTCCCGGCGC TCTTCATCTC GCCGTGGATC
GAGCCGGGCA CGGTGGTGCA CCGGCCGTCG GGGCCGTACC CGACGTCGGA GTTCGAGCAC TCCTCCATCC CGGCCACCGT
GAAGAAGCTC TTCAACCTCA AGAGCTTCCT GACCAACCGC GACGCCTGGG CGGGCACCTT CGACGTCGTC CTCACGCGCG
ACGCGCCGCG CACCGACTGC CCCGCCACCC TGCCGGAGCC ggtgaagatg aggccggcga cggaggcggc ggagcaggcg
gcgctgacgg agTTCCAGGA GGAGCTGGTG CAGCTGGGGG CGGTGCTCAA CGGCGACCAC GCCGACGAGG ACGTGTACCC
GCGCAAGCTG GTGGAGGGGA TGACGGTGGC GGAGGCGGCC AGCTACTGCA ACGCCGCCTT CAAGGCATGG ATGGACGAGT
GCGACCGCTG CAGGAAGTGC GGCGAGGACG GGTCCCACAT CCCCACGGTG GTGAAGCCGC CGCCGCCGCC GTCGACGTCG
TCCTCAGGCT CTAGCTCCTT TGCTTCCAAG TTGCTGTCTT GCTTTGCGTG TGGTCGTCCT AACAAGAATT AG

Locus: Os03g0852800

Loading...

Locus: Os03g0852800

Loading...