Os03t0855100-01

Locus

Os03g0855100

Description

WRKY transcription factor, Defense response to sheath blight pathogen

RAP-DB Gene Symbol Synonym(s)

OsWRKY80

RAP-DB Gene Name Synonym(s)

WRKY80 gene

CGSNL Gene Symbol

WRKY80

CGSNL Gene Name

WRKY GENE 80

Oryzabase Gene Symbol Synonym(s)

OsWRKY80

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK109795

Protein Evidence

Q84T64

Literature

PMID: 27888467

Rice WRKY Working Group 2012. Rice 5:3.

Note

Manual Curation

October 6, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

WRKY domain superfamily (IPR036576)

WRKY domain (IPR003657)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

002-147-E06 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0855100-01)

RiceXPro (AK109795)

Others

Oryzabase (9212)

KEGG (Os03t0855100-01)

Transcript

1623 bp

>Os03t0855100-01 WRKY transcription factor, Defense response to sheath blight pathogen
AATCGAGCTGGTAGTAGCCGGCCAGTAGCACTGTGAGTGCGTGCACTACTAGTGCTCCTG
CAGGCAAGGCTGGACGGGAGTGGGAGTGTGTGTACCAGTACTAGCTACTAGTGAATACTG
AATAGGCAGCAGCAACAGCAGCAGCAGCTAATTAAGCATCAGACAGAAACTAGAAAGAGC
GAGCACGCCACTATGGATATGATGGAGGAGGAGGCTGCCAACGCCGCCACTGCTCAAGCT
GCTGCTGCTGGCGACCTCGCCGACGTCGTGGCCCGTGCCAATGCACGCGCATTCCTCGTC
TCCACCCCTCACCATCACCCCTCACCTCTGCATCCTCTTCCTCCTCCTCCCATGCCTCAG
GCGCCTCACCAATACTATCCCGCCCCCCAGATCACCATCCCTTACCACCACCACCACCAC
GGAGAGCTTCGGCGCCCTACCACCATCGCTTACACCGACGCACCTGTGCCGTTCGAGACG
GCGGGGCCGCCATCCACGGTCGTCGACTCATACCACCACCTCACACCCGGCGACGCCGGC
TACGGGATGCCGCGGCCGCTTGCTCTCCAGATCTCCCAGCACGCCCTCTGTGGCGGCGGC
GACGTGGTGATGGGCGGCGGAGGCGCAGGCGCTGCCGATGATGGAGAAGAAGCCATCAGG
ATCTCGCCACTGACGCCGTCTGCTCATCATCAAATGATGAAAAGGAAGAATGAGGTGAAG
AAAGTGGTGTGCATCCCGGCGCCGCCAGCGACGAGTAGCCGTGGAGGTGGAGGAGAGGTG
ATCCCGTCTGATCTATGGGCATGGAGGAAGTACGGCCAGAAACCCATCAAAGGCTCTCCT
TATCCACGgggttactacagatgcagcagctcaaagggatgtatggcgaggaagcaggtg
gagcgcagccgcagcgaccccaacatgctggtgatcacctacgcggcggagcacaaccac
CCATGGCCGATGCAACGTAATGTGCTCGCCGGATATGCCCGTTCTCATCACAGTACTCAT
GCTACTGCCTCCAGCAGCCGCCACAAGCAACAGCAGCAGCAGCAGACCAACCAGCTGCAG
CCTGCACTGATCACAAGCTCATCGTCTTCTTCCTCCTCCCCATTCAATCTCTACGCCGAC
GTCGTGCTCGGTGGCCAACAGGCCAACATGATGATGACGACGGAGGGCGCCGGCGCTGGA
CTTGGCATCCAACCTTCAGCAGCTGATGAGGTCTTTGCAGAGCTGGAGGAGTTGGAGCCT
GATAATCCTACTATGATCAATGCAAACATGCAGGTGTACTCCACCACCAGCAGGCCAGGG
GTAAGCAGCTATGATCATCAGTGGCACAAGTTCTAATAATTAAACCATGCAGTACCTATA
TATATATATATCAGAACTTCAATATTCGAGAGAGGAGATCAGAGGAAATTGAATTCTAGC
ACGTACAATTAATACATCATGACTATGCAAAATTTACATATATATGATATGATGGTCGCC
TGTGCGATTATTAGTGACCAAATTAAAGATTGTCAGAGATATAGGCGTGTACTTACGCTT
ATATGTATCACGCTGAGGTATACTGTATTTACAAGAAGATAAATAAAATATCCATATCCC
TCT

CDS

1164 bp

>Os03t0855100-01 WRKY transcription factor, Defense response to sheath blight pathogen
ATGGATATGATGGAGGAGGAGGCTGCCAACGCCGCCACTGCTCAAGCTGCTGCTGCTGGC
GACCTCGCCGACGTCGTGGCCCGTGCCAATGCACGCGCATTCCTCGTCTCCACCCCTCAC
CATCACCCCTCACCTCTGCATCCTCTTCCTCCTCCTCCCATGCCTCAGGCGCCTCACCAA
TACTATCCCGCCCCCCAGATCACCATCCCTTACCACCACCACCACCACGGAGAGCTTCGG
CGCCCTACCACCATCGCTTACACCGACGCACCTGTGCCGTTCGAGACGGCGGGGCCGCCA
TCCACGGTCGTCGACTCATACCACCACCTCACACCCGGCGACGCCGGCTACGGGATGCCG
CGGCCGCTTGCTCTCCAGATCTCCCAGCACGCCCTCTGTGGCGGCGGCGACGTGGTGATG
GGCGGCGGAGGCGCAGGCGCTGCCGATGATGGAGAAGAAGCCATCAGGATCTCGCCACTG
ACGCCGTCTGCTCATCATCAAATGATGAAAAGGAAGAATGAGGTGAAGAAAGTGGTGTGC
ATCCCGGCGCCGCCAGCGACGAGTAGCCGTGGAGGTGGAGGAGAGGTGATCCCGTCTGAT
CTATGGGCATGGAGGAAGTACGGCCAGAAACCCATCAAAGGCTCTCCTTATCCACGgggt
tactacagatgcagcagctcaaagggatgtatggcgaggaagcaggtggagcgcagccgc
agcgaccccaacatgctggtgatcacctacgcggcggagcacaaccacCCATGGCCGATG
CAACGTAATGTGCTCGCCGGATATGCCCGTTCTCATCACAGTACTCATGCTACTGCCTCC
AGCAGCCGCCACAAGCAACAGCAGCAGCAGCAGACCAACCAGCTGCAGCCTGCACTGATC
ACAAGCTCATCGTCTTCTTCCTCCTCCCCATTCAATCTCTACGCCGACGTCGTGCTCGGT
GGCCAACAGGCCAACATGATGATGACGACGGAGGGCGCCGGCGCTGGACTTGGCATCCAA
CCTTCAGCAGCTGATGAGGTCTTTGCAGAGCTGGAGGAGTTGGAGCCTGATAATCCTACT
ATGATCAATGCAAACATGCAGGTGTACTCCACCACCAGCAGGCCAGGGGTAAGCAGCTAT
GATCATCAGTGGCACAAGTTCTAA

Protein

387 aa

>Os03t0855100-01 WRKY transcription factor, Defense response to sheath blight pathogen
MDMMEEEAANAATAQAAAAGDLADVVARANARAFLVSTPHHHPSPLHPLPPPPMPQAPHQ
YYPAPQITIPYHHHHHGELRRPTTIAYTDAPVPFETAGPPSTVVDSYHHLTPGDAGYGMP
RPLALQISQHALCGGGDVVMGGGGAGAADDGEEAIRISPLTPSAHHQMMKRKNEVKKVVC
IPAPPATSSRGGGGEVIPSDLWAWRKYGQKPIKGSPYPRGYYRCSSSKGCMARKQVERSR
SDPNMLVITYAAEHNHPWPMQRNVLAGYARSHHSTHATASSSRHKQQQQQQTNQLQPALI
TSSSSSSSSPFNLYADVVLGGQQANMMMTTEGAGAGLGIQPSAADEVFAELEELEPDNPT
MINANMQVYSTTSRPGVSSYDHQWHKF*

5'UTR

chr03:36039164..36039355 (+ strand) : 192 bp

CDS

chr03:36039356..36039867 (+ strand) : 512 bp

chr03:36040543..36040686 (+ strand) : 144 bp

chr03:36043047..36043554 (+ strand) : 508 bp

3'UTR

chr03:36043555..36043821 (+ strand) : 267 bp

FASTA

>Os03t0855100-01 class=Sequence position=chr03:36039164..36043821 (+ strand)
AATCGAGCTG GTAGTAGCCG GCCAGTAGCA CTGTGAGTGC GTGCACTACT AGTGCTCCTG CAGGCAAGGC TGGACGGGAG
TGGGAGTGTG TGTACCAGTA CTAGCTACTA GTGAATACTG AATAGGCAGC AGCAACAGCA GCAGCAGCTA ATTAAGCATC
AGACAGAAAC TAGAAAGAGC GAGCACGCCA CTATGGATAT GATGGAGGAG GAGGCTGCCA ACGCCGCCAC TGCTCAAGCT
GCTGCTGCTG GCGACCTCGC CGACGTCGTG GCCCGTGCCA ATGCACGCGC ATTCCTCGTC TCCACCCCTC ACCATCACCC
CTCACCTCTG CATCCTCTTC CTCCTCCTCC CATGCCTCAG GCGCCTCACC AATACTATCC CGCCCCCCAG ATCACCATCC
CTTACCACCA CCACCACCAC GGAGAGCTTC GGCGCCCTAC CACCATCGCT TACACCGACG CACCTGTGCC GTTCGAGACG
GCGGGGCCGC CATCCACGGT CGTCGACTCA TACCACCACC TCACACCCGG CGACGCCGGC TACGGGATGC CGCGGCCGCT
TGCTCTCCAG ATCTCCCAGC ACGCCCTCTG TGGCGGCGGC GACGTGGTGA TGGGCGGCGG AGGCGCAGGC GCTGCCGATG
ATGGAGAAGA AGCCATCAGG ATCTCGCCAC TGACGCCGTC TGCTCATCAT CAAATGATGA AAAGGTTTGG CATGCTAGCT
AGCTCTTAAC ATTATTAATT AGTTCTCTAA TTAATTGGAT TCATATTTCG ATCACTCCTC TTCTTCCTTA ATGTATACAC
ATCTTGGTCC TTCCTTCAAT TGATGATTTG CATCCCTCTG ATCGATCCCG GCTTTGTGTT ACCGCTTCTT TTTATCACTT
TGATCTTTTT ATTAGTTCAT GCATGTGTGT GTGTGCAGAT ATCTTTGGCT CTCATTTTCA GCATTCCTTT CGATCCATTA
CATATACTGA CAGATTATAT ATATATGAGT CGTCATTAAT TCTGACTTCA TCACCTTTAA GCAAGCTAGC AGGATTTCAT
GGATTGGCAT TTGATGCTTG CACCCCCTAC CCATATCGCC AAATTAATAT TAACTCGATC TTACTCTTCT CAGAGTTTTA
CTCCTCGCAT ATGGCCGTTT TCAGTATTAA TGCTCATATC TAGCAACTGT ACATGTACAC ATAACTCTTT GACAGGTTTG
GAACTAAATC ATACTTGACT TCAGTTCCTC CTAATTTGCT TTTCACGTTT CTCTAATGAG CGAGGAATAC TTACATCAAT
CGATTTCCAA TTAATCAAAA GTCTTAACTA TTTAGTGTTA GTTTATTTTC AAGCAATTAA TTAATTACTT GCTTGCATCC
TTTGGCATAT ATACTACAGG AAGAATGAGG TGAAGAAAGT GGTGTGCATC CCGGCGCCGC CAGCGACGAG TAGCCGTGGA
GGTGGAGGAG AGGTGATCCC GTCTGATCTA TGGGCATGGA GGAAGTACGG CCAGAAACCC ATCAAAGGCT CTCCTTATCC
ACGGTAAACC GGCCACATTT TCATCTGTTT CTTCCCCTCT TTTTTTTTTT AACACGCGCT CACTTAATCG ATCTGTTCAT
ATATATCTTG TACCTAATGA CCCGATTCAT ACATGAAGTT TATTTGCATC AAGATCTCAT CAAATATCTT TCAATCATTC
CTATTCCTCC CATTCTTGAT AAACAATTAA TCACTTTCTG CATAAATATT TTTATACTTA ATGACCGATC CAATTTATAC
GAAGTTTATT GGAATCAAGA GATATCTCAT CAGATATATA TGTTTCGTTC ATTCCTATTG TGTGCTTACT GCTTAGTTAT
ATTATGTTCC CTCTAGGTAT TAATTATATT CATTTTATAT TATGTAAGTT CATTAATATT TATTGCTCAT ATCTCTGCAG
GTACTGTATC TCTGGGCAAA AGCATCAAAA TCATGGCCAT CCTTTTTTAT AAGCTAATTA ACTAAAAAAC AAGCAGCTTC
CATATTTCTT GTTTAGACAA TTTCAATTGG TTTGTCATAA TTAAACAACT TTTGAAATAT ATATATACTG ATCCCCTATG
AGTCCAAGTG TAAGCCATCT TAGCCTTTTT TAAACTCTAA AAGTATGTTG TTTCAAAATT TGCAGGCATC TTTTAATTTC
AACTTATATT TATGGTTTCG GTGTAAAAAA ACTTATATTT ATGGTTTCTC TTGCCAAATA AATTATATTT TTCTCATAAA
TAAACTACCA ATATTTTCCA AAACAATATA AATAAAGGGT AACAAAAGTC GCTTGAGCTA TTTTTTTTTA ATTCTTGCAC
ATAAGTTTTA AATGGCTTAC ATATGGAATA AGGAAGTACA TATATATCTG TACACCCCCC CCCCCCCCCC AATTTTCAAT
TCAAACAACA TTTTTTGTTA GTAAGCCACA ACTTTGGGTT TATTACTTAG CTAGATTACA TGAAGTTCCC CATTATTTGC
TTGTTGGCTT ATAAGTCATT GACACAATTT AAATTgagtt aattgcactt tggtccatct tttattacca aagtttcact
ttttgggcta ccctctagct aatattttca ctttagacta ggtaagatta tctttgttgc agtttggacc accccaagtc
acttttctag tgcatctacc ctctaatctt gtgaataata gtctacatgt gagccaggaa gttagcggtt tatgggtgtt
gatgtggtta aagtcattta tgtgctcgag aaaagttttt gggatggttc aaagtgaaac aaaggcaaac taatctagtc
caaagagaaa agatgtttta aagggtagtt caaagtgaaa ctttggtgat aaaaggtCAT TTACTCATTT ATTTTAAAGT
TAATTTTAAA TTATCCTCCT TTTTTATTTT AAACTTATTT CCAACCTTGG CTTTTTACCA CTAATGGTAT AAATAGTATA
TAAAAGGCCT AACCTAAAAT TATTTTCGGT TGCTTCGTTT ACTTTTGTAT AACTTATCAG CCAAAGCCAA CCAACGTGAA
TAGAACCCAA AATTAATTTA CTGCACAATA CACATTTAAT ATACCAAATC TCCAATGATC CAAATCAAGT ATACAAAACA
TTTCTTTTAG AAAAATAATT CGACAGCATC ATAATAGACA ATATGCTTGT CTATTATTGA TTAATTATTT GTGTAGTGTT
GGGTTTCAAA CTTCCAATGG CACTTGAACG ACCTAATAAG GGTTTGGATG GATATGTATG GATTAATCAA ACGTATATAA
TCACTTCAGA TTGTGTCGGA GTTTCAACAT TGTACCGTCT GAAGGTTATA TATACACCTA TGCCCAAGCA ATCCCTAAAA
TGTAAATCTA TCATCAATGA ATTCTTCCAT ATATACATGG GGATCTAATA AGTGATTCAT CACAATTATG ACCCAATGTA
GTGTCATTTG TGAGAAACTA ATACTCCCAA TTGCAAATTG CGTAAATCAA ACATTATTAA TTGTTGAAAT AGTAGATATT
GCAAGACTGC CACAAATTAA GTTGCTTTTA CTTTTGAGGC AAAAATTGGA ACAAAATAGC TATGTTTGCC GTTTTCAAAT
TAATTTAAAA GGTAAAAATG AAACTTCAAG TACAGGGATC GATAAGCTTA ATTTACTCAC AATTAATTAA ATTTCTCGAT
GAATTAACAA TTATTCTGGC TTAGTGGACT CAGTTTGACA TTACTGTGCC ATCTTCAAAT TTGATCAAAC CATTCATACA
CTGCATTCTA AGGGTATATA TATATCTAGG CACAATAATT TTATATATAT GCGGTTGATC AGGAAATTAA TTAAAAAATA
ATAATTCACT GATGAGTTGA TTTTGTGGGC Ggtgatgatg caggggttac tacagatgca gcagctcaaa gggatgtatg
gcgaggaagc aggtggagcg cagccgcagc gaccccaaca tgctggtgat cacctacgcg gcggagcaca accacCCATG
GCCGATGCAA CGTAATGTGC TCGCCGGATA TGCCCGTTCT CATCACAGTA CTCATGCTAC TGCCTCCAGC AGCCGCCACA
AGCAACAGCA GCAGCAGCAG ACCAACCAGC TGCAGCCTGC ACTGATCACA AGCTCATCGT CTTCTTCCTC CTCCCCATTC
AATCTCTACG CCGACGTCGT GCTCGGTGGC CAACAGGCCA ACATGATGAT GACGACGGAG GGCGCCGGCG CTGGACTTGG
CATCCAACCT TCAGCAGCTG ATGAGGTCTT TGCAGAGCTG GAGGAGTTGG AGCCTGATAA TCCTACTATG ATCAATGCAA
ACATGCAGGT GTACTCCACC ACCAGCAGGC CAGGGGTAAG CAGCTATGAT CATCAGTGGC ACAAGTTCTA ATAATTAAAC
CATGCAGTAC CTATATATAT ATATATCAGA ACTTCAATAT TCGAGAGAGG AGATCAGAGG AAATTGAATT CTAGCACGTA
CAATTAATAC ATCATGACTA TGCAAAATTT ACATATATAT GATATGATGG TCGCCTGTGC GATTATTAGT GACCAAATTA
AAGATTGTCA GAGATATAGG CGTGTACTTA CGCTTATATG TATCACGCTG AGGTATACTG TATTTACAAG AAGATAAATA
AAATATCCAT ATCCCTCT

Locus: Os03g0855100

Loading...

Locus: Os03g0855100

Loading...