Os04t0110600-01

Locus

Os04g0110600

Description

Homolog of Arabidopsis SRP1 (Stress associated RNA-binding protein 1), Salt tolerance

RAP-DB Gene Symbol Synonym(s)

OsSTL1

RAP-DB Gene Name Synonym(s)

salt tolerance level 1

CGSNL Gene Symbol

STL1

CGSNL Gene Name

SALT TOLERANCE LEVEL 1

Oryzabase Gene Symbol Synonym(s)

SRZ4, OsSRZ4, OsSTL1

Oryzabase Gene Name Synonym(s)

stress repressive zinc finger protein 4, salt tolerance level 1

Transcript Evidence

AK065187

Protein Evidence

Q7XXF2

Literature

PMID: 32561778

Note

Manual Curation

July 8, 2020

Functional domain (InterPro)

Zinc finger, RanBP2-type superfamily (IPR036443)

Zinc finger, RanBP2-type (IPR001876)

Full-length cDNA

J013002E01 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0110600-01)

Others

Oryzabase (15133)

Transcript

2353 bp

>Os04t0110600-01 Homolog of Arabidopsis SRP1 (Stress associated RNA-binding protein 1), Salt tolerance
TTCCCACCTCGGAATCTCTGCGCGCGATGGCCGGAGGCGGCGGCGCGGGCTCCTCCACGG
GCGGCTCCGGCGGCGGAGGGGGGCGGGAGGGCGACTGGGACTGCGGCGGCTGCGGCAACC
GCAACTACGCGTTCCGGTCGCTGTGCAACCGGTGCAAGCAGCCCCGTCTCCTGGTCGACC
CCAACACCCCTCCCGACTCCAAGTGGCTCCCCCGCGCCGGCGACTGGATCTGCACCGGTA
ACACCTGCTCCGCCGCGCCAACCACCCTTCCCCCCTGCTCTAATTAATTCCGCACTTGTT
AATTTTTGATCTGCTACACTGGTGCCTGTTTCTACATGAAAAATTATAATATATGTGGTG
GAAAGGGGGAAATCAATGCCAGATGCTGGAAATAATGGCTTTGTGGTTTAGTTTCATGTT
TAGGGTGGGGGTATTGGGATGGGCGACAAACGTGCATCCTCTTCTTTGGGGGAAATCTTG
ATCAACCTAAAGCTTATTATGCTACCTCTGCACACCAGTATTATGCCCTTTTTTACTGTA
TATGCTTAGTTTTTAGGCTTGTTAGAAACCGAGAAGACCGCAGTGCTCGCTCATATTTTT
AGTCGCGTTGTTGCTGTCATAGTTTAAAGAGTTGGGAGTTTTAATGAATAATAACAGTGG
AAATAGAGAGACAACCAAAGGGATATATGTGGAATGTTTGGCTTTCTTTTGCCATTCCAA
CCAAGCTCTGCATCTTGCAATAAAATTTACAGTTGTTCTGACAGAGTTTTGATATGGATG
ATTTCTGTTAGTGGTTCAAGTACTGAGAGCAATTTATCATCAAGAAAAACGACATTTGTC
TGGGACCATGCTATTAATTATTTGCCTTTCTTGTTGGAATTTATTTATTTTCAGCTGCTG
TTTATTTATATTTATTTATTGTGTATTTGATATCCATATATAAAATTAGAAAATTACCAT
TAAGCATGCTGAGTAAATGACTAGTGTGTGTGTCTTTATTCCTTTCATTGGGTTTGTGCG
GGATGGCTGGTTGGTGTGCGTGTGCTTCGGTGCGTTGTCTCCCTGGTGTGCTGGTTGGTT
TATGCGCCAAATGGATGAATAGGTTGCAGTAACAATAATTATGCATCCAGAAAGAACTGC
AAAAAATGTGGCCTGCCGAAGGAGGAAGCAGCAATGCCAGCATTATCAATGGCAGGAATG
GCCATGCCAGCTTATGCAAATTATATTGCTAGGATGCAAGGCCTTGCTGGCTTTAAGATG
AACATGAACTTTGGGATGGCTGGCAATTCAGCTTTGCAACAGCAGCTACTTGCAAGTGCA
AACTGGCCTTATGCGTTGGCTGGTAGATATGGGATGCAAGCTGCTGGCTGGCCATTTGGC
GGCAACAACGCAAATCAGTTTTCAGCGGCTCCAAAAGACTGGCGTAGCGGTGATTGGCTT
TGTAGCTGTGGATTTCATAACTACTCATCTCGCACACAGTGTAAACAGTGTAGTGCTCCT
GTACCATCAGGCATTCCCTCCACAACAATGAAAACCACAGTACCAGATACTTCTTCCACA
TTAGGAACTAAGCGGTTGGCGTCAGAGGAACTTGCCAATGAATGGGATAACAAAAGGCTT
AATCCAGGAAATGCAAGCTATCCACTTTCAACAGCAGGCACGGATAATTTATTTGGTGGT
ATTGAGCAAGGAGCTGGAAGCAGCAATGGCCAGACACCTTATTCCAAGTTTGACAATGGA
AACTCAATAGCGTTACCCTCTGGGCAGGTCTCAGCAATGCCTGGTCTTATTGGAAAAGGA
GCAAAATGGCGCGAAGGAGACTGGATGTGCAGCAACTGCAACAATCACAACTATGCATCT
CGAGCCTTTTGCAACAGGTGCAAAACTCAGAAAGAGGCATCAGTTCATCCCGGTGTGTTA
TAGTTTGCTTGAGAGCCTTTGGTATGTAGCTTGAAGTTTCCTGGATCTGTTGTTGGTGAT
TAGTACCTGAGCGGCCAGGATTTGTTCCCTTTGGGGTTTCGATTCCCCAGTGCTTCAGCT
GCTGTTAAATGTTTGCCCCTCAGTGCTTTACCAGCGCGTTCTGTTGAAGTTTGCTATTTA
TTTTTGTCCGAAGCTTGAATAAAATGGTTCCTCAATGCACCAGCCTGCCATCTGGTTCTT
TGGGAATAATTGAATTAGTTCTTTAGTAATTGGACGATGAACTAGACTCTAATGTTGGGG
ATTTTATTGCTTTGTGAATCAAATGTACCTCCGTGAAGTCTTTGTAATCCTGTTTCAGTA
TTGTTGTATTGAACAGAAAATTGTATGCTGTAATGCACATTCATTTCATTCGAAACCTTC
CTTTTGCTGTTTT

CDS

750 bp

>Os04t0110600-01 Homolog of Arabidopsis SRP1 (Stress associated RNA-binding protein 1), Salt tolerance
ATGCCAGCATTATCAATGGCAGGAATGGCCATGCCAGCTTATGCAAATTATATTGCTAGG
ATGCAAGGCCTTGCTGGCTTTAAGATGAACATGAACTTTGGGATGGCTGGCAATTCAGCT
TTGCAACAGCAGCTACTTGCAAGTGCAAACTGGCCTTATGCGTTGGCTGGTAGATATGGG
ATGCAAGCTGCTGGCTGGCCATTTGGCGGCAACAACGCAAATCAGTTTTCAGCGGCTCCA
AAAGACTGGCGTAGCGGTGATTGGCTTTGTAGCTGTGGATTTCATAACTACTCATCTCGC
ACACAGTGTAAACAGTGTAGTGCTCCTGTACCATCAGGCATTCCCTCCACAACAATGAAA
ACCACAGTACCAGATACTTCTTCCACATTAGGAACTAAGCGGTTGGCGTCAGAGGAACTT
GCCAATGAATGGGATAACAAAAGGCTTAATCCAGGAAATGCAAGCTATCCACTTTCAACA
GCAGGCACGGATAATTTATTTGGTGGTATTGAGCAAGGAGCTGGAAGCAGCAATGGCCAG
ACACCTTATTCCAAGTTTGACAATGGAAACTCAATAGCGTTACCCTCTGGGCAGGTCTCA
GCAATGCCTGGTCTTATTGGAAAAGGAGCAAAATGGCGCGAAGGAGACTGGATGTGCAGC
AACTGCAACAATCACAACTATGCATCTCGAGCCTTTTGCAACAGGTGCAAAACTCAGAAA
GAGGCATCAGTTCATCCCGGTGTGTTATAG

Protein

250 aa

>Os04t0110600-01 Homolog of Arabidopsis SRP1 (Stress associated RNA-binding protein 1), Salt tolerance
MPALSMAGMAMPAYANYIARMQGLAGFKMNMNFGMAGNSALQQQLLASANWPYALAGRYG
MQAAGWPFGGNNANQFSAAPKDWRSGDWLCSCGFHNYSSRTQCKQCSAPVPSGIPSTTMK
TTVPDTSSTLGTKRLASEELANEWDNKRLNPGNASYPLSTAGTDNLFGGIEQGAGSSNGQ
TPYSKFDNGNSIALPSGQVSAMPGLIGKGAKWREGDWMCSNCNNHNYASRAFCNRCKTQK
EASVHPGVL*

5'UTR

chr04:621538..622710 (- strand) : 1173 bp

CDS

chr04:621232..621537 (- strand) : 306 bp

chr04:620660..620738 (- strand) : 79 bp

chr04:620097..620188 (- strand) : 92 bp

chr04:619860..620008 (- strand) : 149 bp

chr04:618741..618818 (- strand) : 78 bp

chr04:617944..617989 (- strand) : 46 bp

3'UTR

chr04:617514..617943 (- strand) : 430 bp

FASTA

>Os04t0110600-01 class=Sequence position=chr04:617514..622710 (- strand)
TTCCCACCTC GGAATCTCTG CGCGCGATGG CCGGAGGCGG CGGCGCGGGC TCCTCCACGG GCGGCTCCGG CGGCGGAGGG
GGGCGGGAGG GCGACTGGGA CTGCGGCGGC TGCGGCAACC GCAACTACGC GTTCCGGTCG CTGTGCAACC GGTGCAAGCA
GCCCCGTCTC CTGGTCGACC CCAACACCCC TCCCGACTCC AAGTGGCTCC CCCGCGCCGG CGACTGGATC TGCACCGGTA
ACACCTGCTC CGCCGCGCCA ACCACCCTTC CCCCCTGCTC TAATTAATTC CGCACTTGTT AATTTTTGAT CTGCTACACT
GGTGCCTGTT TCTACATGAA AAATTATAAT ATATGTGGTG GAAAGGGGGA AATCAATGCC AGATGCTGGA AATAATGGCT
TTGTGGTTTA GTTTCATGTT TAGGGTGGGG GTATTGGGAT GGGCGACAAA CGTGCATCCT CTTCTTTGGG GGAAATCTTG
ATCAACCTAA AGCTTATTAT GCTACCTCTG CACACCAGTA TTATGCCCTT TTTTACTGTA TATGCTTAGT TTTTAGGCTT
GTTAGAAACC GAGAAGACCG CAGTGCTCGC TCATATTTTT AGTCGCGTTG TTGCTGTCAT AGTTTAAAGA GTTGGGAGTT
TTAATGAATA ATAACAGTGG AAATAGAGAG ACAACCAAAG GGATATATGT GGAATGTTTG GCTTTCTTTT GCCATTCCAA
CCAAGCTCTG CATCTTGCAA TAAAATTTAC AGTTGTTCTG ACAGAGTTTT GATATGGATG ATTTCTGTTA GTGGTTCAAG
TACTGAGAGC AATTTATCAT CAAGAAAAAC GACATTTGTC TGGGACCATG CTATTAATTA TTTGCCTTTC TTGTTGGAAT
TTATTTATTT TCAGCTGCTG TTTATTTATA TTTATTTATT GTGTATTTGA TATCCATATA TAAAATTAGA AAATTACCAT
TAAGCATGCT GAGTAAATGA CTAGTGTGTG TGTCTTTATT CCTTTCATTG GGTTTGTGCG GGATGGCTGG TTGGTGTGCG
TGTGCTTCGG TGCGTTGTCT CCCTGGTGTG CTGGTTGGTT TATGCGCCAA ATGGATGAAT AGGTTGCAGT AACAATAATT
ATGCATCCAG AAAGAACTGC AAAAAATGTG GCCTGCCGAA GGAGGAAGCA GCAATGCCAG CATTATCAAT GGCAGGAATG
GCCATGCCAG CTTATGCAAA TTATATTGCT AGGATGCAAG GCCTTGCTGG CTTTAAGATG AACATGAACT TTGGGATGGC
TGGCAATTCA GCTTTGCAAC AGCAGCTACT TGCAAGTGCA AACTGGCCTT ATGCGTTGGC TGGTAGATAT GGGATGCAAG
CTGCTGGCTG GCCATTTGGC GGCAACAACG CAAATCAGTT TTCAGCGGCT CCAAAAGACT GGCGTAGCGG TGATTGGCTT
TGTAGCTGTG GATTTCATAA CTACTCATCT CGCACACAGG TAATTATATA TATACTCTGC TTTAAGTGAT TTCTTGATTC
ACACCCATAA TCATTATTTG TGTAGTTTTG ACCTGCCTTC TGAACCGTAA TGCGTCGTTG TCCACATTTG TTTTTCATGT
CAAACATGTT GATGTGACCT GCTTTCTGAA TAAAATATTT CCTAGACCAT GCATACAGCT ATTTGGTGCT AACTTAATTT
TGGTCCTGAC ATTTGATTAA TATATGATAT CACCTGTTCT CAGGTCAACA TTAGCGTTTT ATGTAAGATG TAATACCTTG
TTGCTTTTCT CACCTTCTAA GGTTCTACAC TTGTGTTTCC TTTTTATTAG TCCTAAAAAT GTGATCGACT AGCTTGCTAT
TACCAGAAAC ATATCCCATG CTCTTTATTC GTGATATAAT GTGAACTCAT GTTCTAGATT CTCAACAGTG TATATTTTAT
CTATCAAGTG CATAGAGTGA CTGGATATCT TCTTTTTTAT TCTCCTTTTC AGTGTAAACA GTGTAGTGCT CCTGTACCAT
CAGGCATTCC CTCCACAACA ATGAAAACCA CAGTACCAGA TACTTCTTCC AGTAAGACAA ATTTCTTACT TCCAAAATAT
TTTCTTTACC TCATGCTCCT AGCCAGTGAA ATAAAAAAAA ATTATCTTCT GATGGGTTAA AAACTGTATT CTCTATTTCA
AAAGGGCACT TCAACTTTGC CTCTTTAATA AGGCAAGTGA TTCTTAGTGG TAAATGCAAA TTCGGAAGTC AGAACTATTT
TCAGATGTTT CATCTGTGGT AATGCGGGGT GATGTTTCTT TGTGATGTCA TATCTCCATG ATTAAcaatt taacataagt
tgataataac catgacccat tccagtttgc tatttttttc atattgctac tgtaatgaat cttatattgt agtttcgaca
tttattccct gttcttgtca cacttgtgct tcatgatctG TCATAAATTA AAGTTCTCTT GTTACATTAA TTGGTGCCAG
CAAATAATCA AATTGTGAGT CTTCAATCTC TTCTTATTTC AGCATTAGGA ACTAAGCGGT TGGCGTCAGA GGAACTTGCC
AATGAATGGG ATAACAAAAG GCTTAATCCA GGAAATGCAA GCTATCCACT TTCAGTATGT GTTTACGATC CTTTTTATTT
GTTATCATAG GTGAGTTCCC TAAGTTTTAC ATGGTATTGA TTTATTTCCA AACTGATTGA AGACAGCAGG CACGGATAAT
TTATTTGGTG GTATTGAGCA AGGAGCTGGA AGCAGCAATG GCCAGACACC TTATTCCAAG TTTGACAATG GAAACTCAAT
AGCGTTACCC TCTGGGCAGG TCTCAGCAAT GCCTGGTCTT ATTGGAAAAG GGTAAGAGAC ATCCTTTAAT GGCTAAAAGG
GCTTTTTTGG CAAGGCCCAA ATCCTGGCCA GGATGGTTTG GGATTTGTGG CTACCCAAAT GAGCCTAATT GAATACTCTG
AATTTGCAAA TCAGCACACA TTGTATTAGT TGTACTGTTT TATAAACTTG CTGTTTTGGG GGGCGTGGAT GTATTATGGC
TTAAGACTAA TCATTTCTGA TAACTTTGCT GAATATTCAA TTCATTAGGA CCATTCAGTT ACATTTTTTT TGGCCATAAA
GCAGTGTCCT CATCTTGGTT TTGCCTGTGG CTATCTGTTT GAAAAGTGAG CACTGGATGC ATGACAGATA TAGAACTCAG
TGACAAAACC GAAACTTATG ATTAGTGACA AACATATTTC ATCAGTTCAA TATTTGCAAG GCAGCGACGA ACGTAGAAAA
ACGAGATTAA CTATTATATT AGAGCAGTGT CACACTGATA TGGAGGTGAC TTGTGTAAGT TGTCGTAACA AGCTCTGATG
GACTGACAGA TGGAGGAATA GTTGATGTAT GGTTCATTAC CATCATAAAT AGTGCTAATA AGATTGGGAG GTCTGAATTC
TGAATAATGC TGGATAGAAG TAGAGATTAA ACAGGTGATT ACGATCCATG GTTGTTAGAG GATCAATAAT AGATAGGTGC
AGGAGGAAAT TGTACTAGTA CAAATCTTGG GTAATTTTTT GAGGAAACAA TGGATGATTG TAAACAGGTT GGGTTTATCT
GGGGTATATT AGCATATACT TCGTATTGTG TAGTTCTGTT TGCGATCATT TGCATGGTCA TTTTTGTTGG TAAAACAATA
TAACAGAATG TGTGGAATTA CTGGATAGAC TCTTGACTCT TGAAGTCCTG TGACTTAATT GTAGTTATTA CTGTTACGTT
AGATTCTTAG AATTTCTGCT TTACACATAT ATGTATTGCT AATATAATTC ATGATTCACT TAAATAATCT ACTTCCATCT
ACACAAGAGG TTGCATAGCT AATGGATTAT GCATGTTCTT GCATCTTATT AGAGCAAAAT GGCGCGAAGG AGACTGGATG
TGCAGCAACT GCAACAATCA CAACTATGCA TCTCGAGCCT TTTGCAACAG GTATTATTCT TTTGCCTATT TTGGTACTTC
TGTTCAACTT TATTGGTATT CAGCTCTAGT TTGGTTTGTG AAGCATGAAT CTTTTGAACT AAACTGGTCA ATAATTTGGC
TATAAATCAC CCTCACACCT CTTTTGTTGC GAATGTTGTA TGCAGAATTC ATATTTTGCT TGTATGAAAT TGATGTTTAA
ATTCACTCTA GTCATGGTCG AACCAATTGT GCCTAGCTGA ACTTGATCCT GGGCAGTTTT AATGATGACT GCATGATGTG
TATAGAGGCC AGGTCATTTC AAGTCCTTAA AATGGAAAAT TTTGCTCTGT GTCTTTGATA ATTGAATGAA AATTGTGTCA
TGTTTTTTCC TTGAACATAT GTTATTCCTG TCCTGTTCTT GATGCCTTAG TATTTTGAAT TATTGTGCTG GTCTGTGCTT
CTTGAATAAT TTTCTGAAAT TATATTGTGA AGGAGTGCAT ATTTTCCATG CCCCAATTCT GTGCTTAAAT TGTTATATTC
CTTGATAATT CTGAGAAACC CACCAATAAG CACCATGTTC TCACATATAA ATTTTCTTCT AACATTTCAT ATGTTGTGCA
TTCTTGTGGT GACTCCTATA GCGTGATATG TGTTTCATAC ATAATATCAA CAAAAACTCC ATACATAATA AGGCTTGAGT
ATGTTGGTTC ATTCTCATTG CTTACTGTTT CCTATTTGTT TTTTTTTTTC CTTTCATTGT AACTGAGGAT ATCATGTGCA
GGTGCAAAAC TCAGAAAGAG GCATCAGTTC ATCCCGGTGT GTTATAGTTT GCTTGAGAGC CTTTGGTATG TAGCTTGAAG
TTTCCTGGAT CTGTTGTTGG TGATTAGTAC CTGAGCGGCC AGGATTTGTT CCCTTTGGGG TTTCGATTCC CCAGTGCTTC
AGCTGCTGTT AAATGTTTGC CCCTCAGTGC TTTACCAGCG CGTTCTGTTG AAGTTTGCTA TTTATTTTTG TCCGAAGCTT
GAATAAAATG GTTCCTCAAT GCACCAGCCT GCCATCTGGT TCTTTGGGAA TAATTGAATT AGTTCTTTAG TAATTGGACG
ATGAACTAGA CTCTAATGTT GGGGATTTTA TTGCTTTGTG AATCAAATGT ACCTCCGTGA AGTCTTTGTA ATCCTGTTTC
AGTATTGTTG TATTGAACAG AAAATTGTAT GCTGTAATGC ACATTCATTT CATTCGAAAC CTTCCTTTTG CTGTTTT

Locus: Os04g0110600

Loading...

Locus: Os04g0110600

Loading...