Os04t0228400-01

Locus

Os04g0228400

Description

Expansin precursor (Alpha-expansin OsEXPA1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

EXPA1

CGSNL Gene Name

ALPHA-EXPANSIN 1

Oryzabase Gene Symbol Synonym(s)

OsEXP1, EXPA1, OsEXPA1, OsaEXPa1.16, RiExA

Oryzabase Gene Name Synonym(s)

Rice expansin-1, Expansin-A1, Alpha-expansin-1, Expansin S2

Transcript Evidence

AK069548 (DDBJ, Best hit)

Protein Evidence

Q01MC7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: plant-type cell wall organization (GO:0009664)

Cellular Component: extracellular region (GO:0005576)

Functional domain (InterPro)

Expansin (IPR002963)

Expansin/pollen allergen, DPBB domain (IPR007112)

Pollen allergen/expansin, C-terminal (IPR007117)

Expansin/Lol pI (IPR007118)

Barwin-related endoglucanase (IPR009009)

Barwin-like endoglucanase (IPR014733)

Full-length cDNA

J023022N21 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0228400-01)

RiceXPro (AK069548)

Others

Oryzabase (2964)

KEGG (Os04t0228400-01)

Transcript

1135 bp

>Os04t0228400-01 Expansin precursor (Alpha-expansin OsEXPA1).
GCCATTAGCAGCACATTCACCGGCAGCACACGCGCGCACACATGGCCGGCTCGTCAGCCG
CAACGTCGTGTGCTCGGTTCCTGGCATTGCTGGCGACATGCCTCCTCTGGAACGAGGCCG
CATCGTTCACGGCGTCCGGCTGGAACAAGGCGTTCGCCACCTTCTACGGCGGCAGTGACG
CTTCAGGAACGATGGGTGGGGCGTGTGGGTACGGGGACCTGTACTCGACGGGGTACGGGA
CGAACACGGCGGCGCTGAGCACGGTGCTGTTCAACGACGGGGCGTCGTGCGGGCAGTGCT
ACCGGATCATGTGCGACTACCAGGCGGACAGGCGGTTCTGCATCTCCGGCACGTCGGTGA
CCATCACGGCGACCAACCTCTGCCCGCCGAACTACGCGCTCCCCAACGACGCCGGCGGGT
GGTGCAACCCGCCGCGGCAGCACTTCGACATGGCCGAACCGGCGTGGCTCAAGATCGGCG
TCTACGTCGGCGGCATCGTGCCGGTGATGTACCAGCGGGTGCCGTGCGCCAAGCAGGGCG
GGGTGAGGTTCACCATCAACGGCAGGGACTACTTCGAGCTGGTGCTCGTCTCCAACGTCG
GCGGCGTCGGCTCCATCCAGTCGGTGTCGATCAAGGGGTCGAGGACCGGGTGGATGGCCA
TGTCCAGGAATTGGGGCGTCAACTGGCAGTCCAACGCCTACCTCGACGGCCAGAGCCTGT
CGTTCAAGGTCACCAGCAGCGACGGCCAGACGCTCACCTTCCTCGACGTCGCCCCGGCGG
GCTGGACGTTCGGCCAGACCTTCTCGACCTCACAGCAGTTCTCTTAAGTAATTAAATATT
AATGAGTTATTACTGGTCCATTCATATATGTGTTTAATTCCGAGCGTATATTATCATCGG
CGTCGGCGTGTAAAGACTAAAGATATATTACTAGTAGCTGTTTGGGTTGCCCACAAGTTT
GGAGCATGCGCGCACAAGTGTTTGGTGTGGCGAGCTATATATATGATTTGCAAGCTAAGG
ACACCTGCTTTTTTCAATGCGAATTAAAACGGTATATATATGTACAGTTTGCGAGGTGCT
TGCCAATCGATGATCGGCATGCTTTACTGTAACGACCACACAAGGAGTTTTCACT

CDS

786 bp

>Os04t0228400-01 Expansin precursor (Alpha-expansin OsEXPA1).
ATGGCCGGCTCGTCAGCCGCAACGTCGTGTGCTCGGTTCCTGGCATTGCTGGCGACATGC
CTCCTCTGGAACGAGGCCGCATCGTTCACGGCGTCCGGCTGGAACAAGGCGTTCGCCACC
TTCTACGGCGGCAGTGACGCTTCAGGAACGATGGGTGGGGCGTGTGGGTACGGGGACCTG
TACTCGACGGGGTACGGGACGAACACGGCGGCGCTGAGCACGGTGCTGTTCAACGACGGG
GCGTCGTGCGGGCAGTGCTACCGGATCATGTGCGACTACCAGGCGGACAGGCGGTTCTGC
ATCTCCGGCACGTCGGTGACCATCACGGCGACCAACCTCTGCCCGCCGAACTACGCGCTC
CCCAACGACGCCGGCGGGTGGTGCAACCCGCCGCGGCAGCACTTCGACATGGCCGAACCG
GCGTGGCTCAAGATCGGCGTCTACGTCGGCGGCATCGTGCCGGTGATGTACCAGCGGGTG
CCGTGCGCCAAGCAGGGCGGGGTGAGGTTCACCATCAACGGCAGGGACTACTTCGAGCTG
GTGCTCGTCTCCAACGTCGGCGGCGTCGGCTCCATCCAGTCGGTGTCGATCAAGGGGTCG
AGGACCGGGTGGATGGCCATGTCCAGGAATTGGGGCGTCAACTGGCAGTCCAACGCCTAC
CTCGACGGCCAGAGCCTGTCGTTCAAGGTCACCAGCAGCGACGGCCAGACGCTCACCTTC
CTCGACGTCGCCCCGGCGGGCTGGACGTTCGGCCAGACCTTCTCGACCTCACAGCAGTTC
TCTTAA

Protein

262 aa

>Os04t0228400-01 Expansin precursor (Alpha-expansin OsEXPA1).
MAGSSAATSCARFLALLATCLLWNEAASFTASGWNKAFATFYGGSDASGTMGGACGYGDL
YSTGYGTNTAALSTVLFNDGASCGQCYRIMCDYQADRRFCISGTSVTITATNLCPPNYAL
PNDAGGWCNPPRQHFDMAEPAWLKIGVYVGGIVPVMYQRVPCAKQGGVRFTINGRDYFEL
VLVSNVGGVGSIQSVSIKGSRTGWMAMSRNWGVNWQSNAYLDGQSLSFKVTSSDGQTLTF
LDVAPAGWTFGQTFSTSQQFS*

5'UTR

chr04:8599014..8599054 (+ strand) : 41 bp

CDS

chr04:8599055..8599208 (+ strand) : 154 bp

chr04:8599309..8599940 (+ strand) : 632 bp

3'UTR

chr04:8599941..8600248 (+ strand) : 308 bp

FASTA

>Os04t0228400-01 class=Sequence position=chr04:8599014..8600248 (+ strand)
GCCATTAGCA GCACATTCAC CGGCAGCACA CGCGCGCACA CATGGCCGGC TCGTCAGCCG CAACGTCGTG TGCTCGGTTC
CTGGCATTGC TGGCGACATG CCTCCTCTGG AACGAGGCCG CATCGTTCAC GGCGTCCGGC TGGAACAAGG CGTTCGCCAC
CTTCTACGGC GGCAGTGACG CTTCAGGAAC GATGGGTAAG TTCGTAGCTA GCTAGCTACT GTAGCTAGGA ATGGATCCAT
CGTGCAATCG GTGACGTTGG TTCATGTGCA TGCGTGTCGT CGTGTGTGTG TGCAGGTGGG GCGTGTGGGT ACGGGGACCT
GTACTCGACG GGGTACGGGA CGAACACGGC GGCGCTGAGC ACGGTGCTGT TCAACGACGG GGCGTCGTGC GGGCAGTGCT
ACCGGATCAT GTGCGACTAC CAGGCGGACA GGCGGTTCTG CATCTCCGGC ACGTCGGTGA CCATCACGGC GACCAACCTC
TGCCCGCCGA ACTACGCGCT CCCCAACGAC GCCGGCGGGT GGTGCAACCC GCCGCGGCAG CACTTCGACA TGGCCGAACC
GGCGTGGCTC AAGATCGGCG TCTACGTCGG CGGCATCGTG CCGGTGATGT ACCAGCGGGT GCCGTGCGCC AAGCAGGGCG
GGGTGAGGTT CACCATCAAC GGCAGGGACT ACTTCGAGCT GGTGCTCGTC TCCAACGTCG GCGGCGTCGG CTCCATCCAG
TCGGTGTCGA TCAAGGGGTC GAGGACCGGG TGGATGGCCA TGTCCAGGAA TTGGGGCGTC AACTGGCAGT CCAACGCCTA
CCTCGACGGC CAGAGCCTGT CGTTCAAGGT CACCAGCAGC GACGGCCAGA CGCTCACCTT CCTCGACGTC GCCCCGGCGG
GCTGGACGTT CGGCCAGACC TTCTCGACCT CACAGCAGTT CTCTTAAGTA ATTAAATATT AATGAGTTAT TACTGGTCCA
TTCATATATG TGTTTAATTC CGAGCGTATA TTATCATCGG CGTCGGCGTG TAAAGACTAA AGATATATTA CTAGTAGCTG
TTTGGGTTGC CCACAAGTTT GGAGCATGCG CGCACAAGTG TTTGGTGTGG CGAGCTATAT ATATGATTTG CAAGCTAAGG
ACACCTGCTT TTTTCAATGC GAATTAAAAC GGTATATATA TGTACAGTTT GCGAGGTGCT TGCCAATCGA TGATCGGCAT
GCTTTACTGT AACGACCACA CAAGGAGTTT TCACT

Locus: Os04g0228400

Loading...

Locus: Os04g0228400

Loading...