Os04t0229100-01

Locus

Os04g0229100

Description

Similar to Sinapyl alcohol dehydrogenase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAD6

CGSNL Gene Name

CINNAMYL ALCOHOL DEHYDROGENASE 6

Oryzabase Gene Symbol Synonym(s)

OsCAD6

Oryzabase Gene Name Synonym(s)

Cinnamyl alcohol dehydrogenase 6

Transcript Evidence

AK071484 (DDBJ, Best hit)

AK099270 (DDBJ, Best hit)

Protein Evidence

Q01MC2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Alcohol dehydrogenase superfamily, zinc-type (IPR002085)

Alcohol dehydrogenase, zinc-type, conserved site (IPR002328)

GroES-like (IPR011032)

Alcohol dehydrogenase, C-terminal (IPR013149)

Alcohol dehydrogenase GroES-like (IPR013154)

NAD(P)-binding domain (IPR016040)

Polyketide synthase, enoylreductase (IPR020843)

Full-length cDNA

J023091M10 (Online Clone Ordering)

J023021L06 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0229100-01)

RiceXPro (AK071484)

Others

Oryzabase (10435)

KEGG (Os04t0229100-01)

Transcript

1376 bp

>Os04t0229100-01 Similar to Sinapyl alcohol dehydrogenase.
GTATATAGTCCTAACCAACAGTCAGGAACAGCAACAAAAGTAAGCCAAGAATCTCTCTGC
CTCCCACCAACAACCACACACACTCACAGCTTTGGTCATGGAGGTCACCCCCAACCACAC
GCAGACCGTCTCCGGCTGGGCCGCCATGGACGAGTCCGGCAAGATCGTGCCCTTCGTCTT
CAAGAGAAGGGAGAACGGGGTGGACGACGTGACGATCAAGGTGAAGTACTGCGGGATGTG
CCACACGGACCTGCACTTCATCCACAACGACTGGGGGATCACCATGTACCCGGTGGTGCC
GGGGCACGAGATCACCGGCGTGGTGACCAAGGTGGGCACCAACGTGGCCGGGTTCAAGGT
GGGCGACCGCGTGGGCGTGGGGTGCATCGCGGCGTCGTGCCTCGACTGCGAGCACTGCCG
GCGGTCGGAGGAGAACTACTGCGACAAGGTGGCGCTCACCTACAACGGCATCTTCTGGGA
CGGCAGCATCACCTACGGCGGCTACTCCGGCATGCTGGTGGCGCACAAGCGGTTCGTCGT
GCGGATCCCGGACACCCTCCCGCTGGACGCCGCGGCGCCGCTGCTGTGCGCGGGCATCAC
GGTGTACAGCCCCATGAAGCAGCACGGCATGCTGCAGGCCGACGCGGCCGGCCGGCGGCT
CGGCGTGGTCGGCCTCGGCGGCCTCGGCCACGTCGCCGTCAAGTTCGGCAAGGCGTTCGG
CCTCCACGTCACCGTCATCAGCACGTCTCCGGCCAAGGAGCGCGAGGCCAGGGAGAACCT
CAAGGCCGACAACTTCGTCGTCAGCACCGACCAGAAGCAGATGCAGGCTATGACGAGGAG
CCTTGACTACATCATTGACACGGTCGCGGCGACGCACTCTCTGGGTCCGATCCTGGAGCT
GCTCAAGGTCAACGGCAAGCTGGTGCTCGTGGGCGCGCCGGAGAAGCCCGTCGAGCTCCC
TTCCTTCCCTCTCATCTTCGGTAAGAGGACGGTGAGTGGGAGCATGACGGGTGGGATGAA
GGAGACGCAGGAGATGATGGACATTTGCGGGGAGCACAACATCACCTGCGACATCGAGAT
CGTGTCCACGGACAGGATCAACGATGCGCTCGCCAGGTTGGCGCGCAACGACGTCCGCTA
CCGCTTCGTCATCAACGTTGGGGGCGACTCCAAGCTCTAGACTCATGCTACTATCATATT
GCTACCTAGTACCAACCTCCATGCCTTTCTTAATTTAATTTATTGGAGGCTCTGCACGCA
GAATGGGACAGTTCGAGCTGTCGTTTTCTCGTTGGCCACGTGAAGTAACTGTACGCACTT
TGTACTTATTCGAGAAATGATCAGTGATAAATCATCAATGGCCTTATTTTATTCTT

CDS

1083 bp

>Os04t0229100-01 Similar to Sinapyl alcohol dehydrogenase.
ATGGAGGTCACCCCCAACCACACGCAGACCGTCTCCGGCTGGGCCGCCATGGACGAGTCC
GGCAAGATCGTGCCCTTCGTCTTCAAGAGAAGGGAGAACGGGGTGGACGACGTGACGATC
AAGGTGAAGTACTGCGGGATGTGCCACACGGACCTGCACTTCATCCACAACGACTGGGGG
ATCACCATGTACCCGGTGGTGCCGGGGCACGAGATCACCGGCGTGGTGACCAAGGTGGGC
ACCAACGTGGCCGGGTTCAAGGTGGGCGACCGCGTGGGCGTGGGGTGCATCGCGGCGTCG
TGCCTCGACTGCGAGCACTGCCGGCGGTCGGAGGAGAACTACTGCGACAAGGTGGCGCTC
ACCTACAACGGCATCTTCTGGGACGGCAGCATCACCTACGGCGGCTACTCCGGCATGCTG
GTGGCGCACAAGCGGTTCGTCGTGCGGATCCCGGACACCCTCCCGCTGGACGCCGCGGCG
CCGCTGCTGTGCGCGGGCATCACGGTGTACAGCCCCATGAAGCAGCACGGCATGCTGCAG
GCCGACGCGGCCGGCCGGCGGCTCGGCGTGGTCGGCCTCGGCGGCCTCGGCCACGTCGCC
GTCAAGTTCGGCAAGGCGTTCGGCCTCCACGTCACCGTCATCAGCACGTCTCCGGCCAAG
GAGCGCGAGGCCAGGGAGAACCTCAAGGCCGACAACTTCGTCGTCAGCACCGACCAGAAG
CAGATGCAGGCTATGACGAGGAGCCTTGACTACATCATTGACACGGTCGCGGCGACGCAC
TCTCTGGGTCCGATCCTGGAGCTGCTCAAGGTCAACGGCAAGCTGGTGCTCGTGGGCGCG
CCGGAGAAGCCCGTCGAGCTCCCTTCCTTCCCTCTCATCTTCGGTAAGAGGACGGTGAGT
GGGAGCATGACGGGTGGGATGAAGGAGACGCAGGAGATGATGGACATTTGCGGGGAGCAC
AACATCACCTGCGACATCGAGATCGTGTCCACGGACAGGATCAACGATGCGCTCGCCAGG
TTGGCGCGCAACGACGTCCGCTACCGCTTCGTCATCAACGTTGGGGGCGACTCCAAGCTC
TAG

Protein

361 aa

>Os04t0229100-01 Similar to Sinapyl alcohol dehydrogenase.
MEVTPNHTQTVSGWAAMDESGKIVPFVFKRRENGVDDVTIKVKYCGMCHTDLHFIHNDWG
ITMYPVVPGHEITGVVTKVGTNVAGFKVGDRVGVGCIAASCLDCEHCRRSEENYCDKVAL
TYNGIFWDGSITYGGYSGMLVAHKRFVVRIPDTLPLDAAAPLLCAGITVYSPMKQHGMLQ
ADAAGRRLGVVGLGGLGHVAVKFGKAFGLHVTVISTSPAKEREARENLKADNFVVSTDQK
QMQAMTRSLDYIIDTVAATHSLGPILELLKVNGKLVLVGAPEKPVELPSFPLIFGKRTVS
GSMTGGMKETQEMMDICGEHNITCDIEIVSTDRINDALARLARNDVRYRFVINVGGDSKL
*

5'UTR

chr04:8639249..8639345 (- strand) : 97 bp

CDS

chr04:8639157..8639248 (- strand) : 92 bp

chr04:8638427..8639063 (- strand) : 637 bp

chr04:8637813..8637966 (- strand) : 154 bp

chr04:8637510..8637709 (- strand) : 200 bp

3'UTR

chr04:8637314..8637509 (- strand) : 196 bp

FASTA

>Os04t0229100-01 class=Sequence position=chr04:8637314..8639345 (- strand)
GTATATAGTC CTAACCAACA GTCAGGAACA GCAACAAAAG TAAGCCAAGA ATCTCTCTGC CTCCCACCAA CAACCACACA
CACTCACAGC TTTGGTCATG GAGGTCACCC CCAACCACAC GCAGACCGTC TCCGGCTGGG CCGCCATGGA CGAGTCCGGC
AAGATCGTGC CCTTCGTCTT CAAGAGAAGG TATAAAGAAA TGAGCAAGAA GTGATTGATA TTTGGATAGA TTTAGATGTA
GCTTGTTGTT GAGAATGAGA TTTATTGCAT GGGTGGTTGC AGGGAGAACG GGGTGGACGA CGTGACGATC AAGGTGAAGT
ACTGCGGGAT GTGCCACACG GACCTGCACT TCATCCACAA CGACTGGGGG ATCACCATGT ACCCGGTGGT GCCGGGGCAC
GAGATCACCG GCGTGGTGAC CAAGGTGGGC ACCAACGTGG CCGGGTTCAA GGTGGGCGAC CGCGTGGGCG TGGGGTGCAT
CGCGGCGTCG TGCCTCGACT GCGAGCACTG CCGGCGGTCG GAGGAGAACT ACTGCGACAA GGTGGCGCTC ACCTACAACG
GCATCTTCTG GGACGGCAGC ATCACCTACG GCGGCTACTC CGGCATGCTG GTGGCGCACA AGCGGTTCGT CGTGCGGATC
CCGGACACCC TCCCGCTGGA CGCCGCGGCG CCGCTGCTGT GCGCGGGCAT CACGGTGTAC AGCCCCATGA AGCAGCACGG
CATGCTGCAG GCCGACGCGG CCGGCCGGCG GCTCGGCGTG GTCGGCCTCG GCGGCCTCGG CCACGTCGCC GTCAAGTTCG
GCAAGGCGTT CGGCCTCCAC GTCACCGTCA TCAGCACGTC TCCGGCCAAG GAGCGCGAGG CCAGGGAGAA CCTCAAGGCC
GACAACTTCG TCGTCAGCAC CGACCAGAAG CAGATGCAGG TAATTACATA CGAATATACG ATTGAACTCC AAGGCAACCT
CATCATGTGC ACGCATAAGA TTAATTAGTT TTTTTTAAAA AAAAACGAAC CGATCGCAAA CGTGTCAATT TCATTGGAAA
TAATAGGAGT AAAAGTTATC AATACAAGTA TGAAAAAAAC CTACTATATG AGAAGTAAGA ACACTACGAC AGCATAATAA
GCGAGATGTG CTTTGCCCCT GCTATCGCTC AAGTTCTGCC TTCCTTAATC TCTGCTCCTA ACGATGTGAA AAAAAGAAAA
AGGCTCTTTG CGCTGAAAAC TCCCCGGGGT TATCCGCTCT CCTTCCAAAC CTCTCACGCG AGGATTAGTG TGTGGAATTC
TTTTTTCGGA AGTTCTTTAG CCGTCATTCA AGATTAGTGG AGTACTAATT TAATTAAGCA CTGAACTAGT TAATTACTTA
ATTTACTGCA ATAAATTAGG CTATGACGAG GAGCCTTGAC TACATCATTG ACACGGTCGC GGCGACGCAC TCTCTGGGTC
CGATCCTGGA GCTGCTCAAG GTCAACGGCA AGCTGGTGCT CGTGGGCGCG CCGGAGAAGC CCGTCGAGCT CCCTTCCTTC
CCTCTCATCT TCGGTGAGCA TTTGAGCAAT CACCCATCAA GTTAATTTAA TTACTACTAC GCTACTTAGT AGTATCTGCC
AACTAATCAA TCAATTAATT CGTGGGTTGC GTGCAGGTAA GAGGACGGTG AGTGGGAGCA TGACGGGTGG GATGAAGGAG
ACGCAGGAGA TGATGGACAT TTGCGGGGAG CACAACATCA CCTGCGACAT CGAGATCGTG TCCACGGACA GGATCAACGA
TGCGCTCGCC AGGTTGGCGC GCAACGACGT CCGCTACCGC TTCGTCATCA ACGTTGGGGG CGACTCCAAG CTCTAGACTC
ATGCTACTAT CATATTGCTA CCTAGTACCA ACCTCCATGC CTTTCTTAAT TTAATTTATT GGAGGCTCTG CACGCAGAAT
GGGACAGTTC GAGCTGTCGT TTTCTCGTTG GCCACGTGAA GTAACTGTAC GCACTTTGTA CTTATTCGAG AAATGATCAG
TGATAAATCA TCAATGGCCT TATTTTATTC TT

Locus: Os04g0229100

Loading...

Locus: Os04g0229100

Loading...