Os04t0249600-01

Locus

Os04g0249600

Description

Similar to senescence-associated protein DIN1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

STR6

CGSNL Gene Name

SULFURTRANSFERASE 6

Oryzabase Gene Symbol Synonym(s)

OsStr6, OsRhST, RLD, OsHAC1;2, HAC1;2

Oryzabase Gene Name Synonym(s)

Sulfurtransferase 6, rhodanese-related sulfurtransferase, rhodanese-like domain-containing protein, High As Content 1;2

Transcript Evidence

AK069432 (DDBJ, Best hit)

Protein Evidence

NP_001152690.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Rhodanese-like (IPR001763)

Full-length cDNA

J023019G15 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0249600-01)

RiceXPro (AK069432)

Others

Oryzabase (12056)

KEGG (Os04t0249600-01)

Transcript

1891 bp

>Os04t0249600-01 Similar to senescence-associated protein DIN1.
GGCAGGCACCCACAGAACTTTCGTTGCCGACTGCGGCTGCAACCGGAATGTAGCCGGCCT
GTGTGCTACTTCCAGCCACAAGCAGAGGCCGCGACATTAATCTCACAGGAAATCTAGTCG
TCTAGTAACTCTACTGCCAAATCTTGATATCTTGAAAGCTTTCAATTCAGCTTGCAATAT
ATCAATACCTGTTCCCCTTTCCTAATTCCTACCCTTCCTCCTCGTGCTACAGCCCTGCCG
TTCTTTGGGATGATGATGATGGTGAGATTGCCTGCTATGTTCGTGATCTGCATCTTGGCT
GTTCCGCTGCTGCCAGCGCTCGGCTCGGAGCCGCCGTCGACACCGGTGCCGACCGTTGGC
GTGACGGCGGCGAGCCACCTCGTCGGCTCCGGTGGCCACAGCTACTTGGACGTCAGGACA
GAAGAGGAATTCAAGAAGGGACATGTGGAGAATTCTCTTAATGTGCCATTCCTCTTCTTT
ACCCCTCAAGGGAAGGAAAAGAACACAAAGTTCATAGAGCAGGTGGCATTGCATTATGAT
AAGGAGGACAACATAATTGTGGGTTGCCTAAGTGGAGTAAGATCTGAACTAGCATCTGCC
GATCTCATAGCAGCCGTAAGACCTCTCCCCCCTTGAGCGCTCCTGTTGTTTCTAAATCTG
ATTTATATATTTTAACTTAGGACTTTGATATTCATAAAATTTTGTAGTAACTTTTTTTAG
ATAATGGGAAATTGTTAGAGCAAGTAAGTACGATACTTTTTCTCCTGTGTCCCTCAATTT
AAGTAGGTTAAACATTGTCTGACGGGTGAAAGACTTGAATAGGTGAACATAGCATTGAAT
TTGGTGGATAATAATAGTGTTTTATATGCATGAAAAAGATAGAATTTGTATGTCAGGCGA
TTTGCCTAATGCAATCCTAATTTTACTCCTAAAATTACATTTGAGCAATTTGTGTACTGA
ATATTAGAATTTTGCTCCCAACTAAACTTTAATTCCGGTATTGTTCTTATTTTGTTATGT
ACAGGTTCTTGGATACTGTGACTGTGACCATCGTACAATCAAATCGATATAAAAACACTA
ATGTTAATAGTAAATTAGAATTGAACGAAATGCACGCGAAGTTAGCGTAGGCCATGAGAG
ATGGATTGTGGTTTCTCACATAATAAAGAGTTAATTTAATCCATGCCATTATAATCAGCA
GCACCTCTTAAACAGTTTGGTAAAGGAATAAGTTCATTTTACACCCAGCTTTAAAATGGC
TTATTTAACATATTTGTGTTATGTAGTACTCCCTCTGATCAAGATTACATGACGTTTCCG
ACAGCCAAAACCTATTAAGCGCAATTCATTTTGTTTGTTCAAAGCATCAAATAATATCGT
CCGGAGGTAGTACTATGACAAACATACCTTGGAGAAAATTTCCTACTTGTATTAATAAAG
GAGGAACTTGAGTGTGTATTTACAAGGTATGCCCAGGACACGTGCACAAAAATACTGTTC
TCACAAAGTCTGCTTCTTGGTCGCTGCCACTACTCTCTCTGTGATATCCACATTTTTTTT
CTGAAAGAATAAATTAGGGTGCACATAAGCTTTCATATTTAACAGTCCCCTTTTTCAGAT
TCAGTATCTCGATCATTCCCTTGTTAGTTTCCTTTGTTTATGTCTCAAACATTTGATATG
GAAACAGGGATTCAAAAATGTAAAGAACATGGAAGGAGGTTACATGGCATGGGTGGAAAA
TGGCCTTGCGGTGAATAAACCTCTAGTGCAAGAAGAGCTCTAGTTTCAGTTATTGTATTT
TTAGATAATGACTTTCAGTTATTGTATGACTGGGTGTTAATTTGATTTGTAGAAAGGAAA
GGTATAAGAAAACAATGTTATATTATTCCCC

CDS

387 bp

>Os04t0249600-01 Similar to senescence-associated protein DIN1.
ATGATGATGATGGTGAGATTGCCTGCTATGTTCGTGATCTGCATCTTGGCTGTTCCGCTG
CTGCCAGCGCTCGGCTCGGAGCCGCCGTCGACACCGGTGCCGACCGTTGGCGTGACGGCG
GCGAGCCACCTCGTCGGCTCCGGTGGCCACAGCTACTTGGACGTCAGGACAGAAGAGGAA
TTCAAGAAGGGACATGTGGAGAATTCTCTTAATGTGCCATTCCTCTTCTTTACCCCTCAA
GGGAAGGAAAAGAACACAAAGTTCATAGAGCAGGTGGCATTGCATTATGATAAGGAGGAC
AACATAATTGTGGGTTGCCTAAGTGGAGTAAGATCTGAACTAGCATCTGCCGATCTCATA
GCAGCCGTAAGACCTCTCCCCCCTTGA

Protein

129 aa

>Os04t0249600-01 Similar to senescence-associated protein DIN1.
MMMMVRLPAMFVICILAVPLLPALGSEPPSTPVPTVGVTAASHLVGSGGHSYLDVRTEEE
FKKGHVENSLNVPFLFFTPQGKEKNTKFIEQVALHYDKEDNIIVGCLSGVRSELASADLI
AAVRPLPP*

5'UTR

chr04:9673775..9674023 (- strand) : 249 bp

CDS

chr04:9673608..9673774 (- strand) : 167 bp

chr04:9673063..9673137 (- strand) : 75 bp

chr04:9672814..9672883 (- strand) : 70 bp

chr04:9672623..9672697 (- strand) : 75 bp

3'UTR

chr04:9671368..9672622 (- strand) : 1255 bp

FASTA

>Os04t0249600-01 class=Sequence position=chr04:9671368..9674023 (- strand)
GGCAGGCACC CACAGAACTT TCGTTGCCGA CTGCGGCTGC AACCGGAATG TAGCCGGCCT GTGTGCTACT TCCAGCCACA
AGCAGAGGCC GCGACATTAA TCTCACAGGA AATCTAGTCG TCTAGTAACT CTACTGCCAA ATCTTGATAT CTTGAAAGCT
TTCAATTCAG CTTGCAATAT ATCAATACCT GTTCCCCTTT CCTAATTCCT ACCCTTCCTC CTCGTGCTAC AGCCCTGCCG
TTCTTTGGGA TGATGATGAT GGTGAGATTG CCTGCTATGT TCGTGATCTG CATCTTGGCT GTTCCGCTGC TGCCAGCGCT
CGGCTCGGAG CCGCCGTCGA CACCGGTGCC GACCGTTGGC GTGACGGCGG CGAGCCACCT CGTCGGCTCC GGTGGCCACA
GCTACTTGGA CGTCAGGTTG TTGCTCTATG CCTCTATGCA TCATTATTAG TATTATTCCA TTCTCGGTGT GTCCATAAGT
AAGTTAATTG ATTAGCTAAT GGCGCATTGC GACCCACCAA TCTCGAAATG GACCTGCAAG CCAAGCGAAT CTTGAACCCT
TCGCCATAAG CTTCTGTTAT TTTTTCGTCC CAAATTTCCA GTTCAGGCTT CTGCACATGC GGATTTCGTT TGCGGTTACC
TTGATTCTGA CATAACCCAG TAATAGGATC TGCTGCCAAG CTAGATTACA ACCAGTTTCT TGATTTGACC ACACTAGAAT
TAATCATCTC GTAAGGAATG CAGACGATTT GCCGCCTATG ATGAATATGT TACCCTTCTC AACCCATCCA CCGATTTTTC
TTAAAAAAAA TGGTATATCC ACTGATTTCT ATGAATTGAA GGACTATCTA GACCGTTTTA TTTTTTAACC AACTGCCGTT
CAACAGGACA GAAGAGGAAT TCAAGAAGGG ACATGTGGAG AATTCTCTTA ATGTGCCATT CCTCTTCTTT ACCCCTCAAG
GCAAGATTCC TTAACTTGCT TCCCTAGTTT TGTCCTGCCC TTCATTATAC ATATTTTCTA AGAAAAAAAG ATATATCAAG
AATTCTTCTT CCAGGAAAAG AAAACTGCAC ACTTTAAGAG TGATATGCCA TTGTTAGCCT GAATTGTATT ACTGATTTAA
CCTGTTATTG AATCATCAGG GAAGGAAAAG AACACAAAGT TCATAGAGCA GGTGGCATTG CATTATGATA AGGAGGACAA
CATAATTGTG GTATTACTTA TGATTTGTCT ATACATATTT AACTAGTAAT ATATAAGACA AAATATCTGG TTTTATATTT
ATGGACCTTC ATTTAGTTTG TGATTACGTT TGTCCATTTT TTCAAGGGTT GCCTAAGTGG AGTAAGATCT GAACTAGCAT
CTGCCGATCT CATAGCAGCC GTAAGACCTC TCCCCCCTTG AGCGCTCCTG TTGTTTCTAA ATCTGATTTA TATATTTTAA
CTTAGGACTT TGATATTCAT AAAATTTTGT AGTAACTTTT TTTAGATAAT GGGAAATTGT TAGAGCAAGT AAGTACGATA
CTTTTTCTCC TGTGTCCCTC AATTTAAGTA GGTTAAACAT TGTCTGACGG GTGAAAGACT TGAATAGGTG AACATAGCAT
TGAATTTGGT GGATAATAAT AGTGTTTTAT ATGCATGAAA AAGATAGAAT TTGTATGTCA GGCGATTTGC CTAATGCAAT
CCTAATTTTA CTCCTAAAAT TACATTTGAG CAATTTGTGT ACTGAATATT AGAATTTTGC TCCCAACTAA ACTTTAATTC
CGGTATTGTT CTTATTTTGT TATGTACAGG TTCTTGGATA CTGTGACTGT GACCATCGTA CAATCAAATC GATATAAAAA
CACTAATGTT AATAGTAAAT TAGAATTGAA CGAAATGCAC GCGAAGTTAG CGTAGGCCAT GAGAGATGGA TTGTGGTTTC
TCACATAATA AAGAGTTAAT TTAATCCATG CCATTATAAT CAGCAGCACC TCTTAAACAG TTTGGTAAAG GAATAAGTTC
ATTTTACACC CAGCTTTAAA ATGGCTTATT TAACATATTT GTGTTATGTA GTACTCCCTC TGATCAAGAT TACATGACGT
TTCCGACAGC CAAAACCTAT TAAGCGCAAT TCATTTTGTT TGTTCAAAGC ATCAAATAAT ATCGTCCGGA GGTAGTACTA
TGACAAACAT ACCTTGGAGA AAATTTCCTA CTTGTATTAA TAAAGGAGGA ACTTGAGTGT GTATTTACAA GGTATGCCCA
GGACACGTGC ACAAAAATAC TGTTCTCACA AAGTCTGCTT CTTGGTCGCT GCCACTACTC TCTCTGTGAT ATCCACATTT
TTTTTCTGAA AGAATAAATT AGGGTGCACA TAAGCTTTCA TATTTAACAG TCCCCTTTTT CAGATTCAGT ATCTCGATCA
TTCCCTTGTT AGTTTCCTTT GTTTATGTCT CAAACATTTG ATATGGAAAC AGGGATTCAA AAATGTAAAG AACATGGAAG
GAGGTTACAT GGCATGGGTG GAAAATGGCC TTGCGGTGAA TAAACCTCTA GTGCAAGAAG AGCTCTAGTT TCAGTTATTG
TATTTTTAGA TAATGACTTT CAGTTATTGT ATGACTGGGT GTTAATTTGA TTTGTAGAAA GGAAAGGTAT AAGAAAACAA
TGTTATATTA TTCCCC

Locus: Os04g0249600

Loading...

Locus: Os04g0249600

Loading...