Os04t0249600-02

Locus

Os04g0249600

Description

Arsenate reductase, Sulfurtransferase/rhodanese-like protein, Regulation of arsenic accumulation

RAP-DB Gene Symbol Synonym(s)

STR6, OsHAC1;2, OsStr6, OsRhST, RLD

RAP-DB Gene Name Synonym(s)

SULFURTRANSFERASE 6, Sulfurtransferase 6, rhodanese-related sulfurtransferase, rhodanese-like domain-containing protein

CGSNL Gene Symbol

STR6

CGSNL Gene Name

SULFURTRANSFERASE 6

Oryzabase Gene Symbol Synonym(s)

OsStr6, OsRhST, RLD, OsHAC1;2, HAC1;2

Oryzabase Gene Name Synonym(s)

Sulfurtransferase 6, rhodanese-related sulfurtransferase, rhodanese-like domain-containing protein, High As Content 1;2

Transcript Evidence

Inferred from literature

Protein Evidence

Inferred from literature

Literature

PMID: 27702843

PMID: 21821426

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

November 7, 2016

Functional domain (InterPro)

Rhodanese-like domain (IPR001763)

Full-length cDNA

002-180-F02(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os04t0249600-02)

RiceXPro (AK119900)

Others

Oryzabase (12056)

KEGG (Os04t0249600-02)

Transcript

570 bp

>Os04t0249600-02 Arsenate reductase, Sulfurtransferase/rhodanese-like protein, Regulation of arsenic accumulation
ATGATGATGATGGTGAGATTGCCTGCTATGTTCGTGATCTGCATCTTGGCTGTTCCGCTG
CTGCCAGCGCTCGGCTCGGAGCCGCCGTCGACACCGGTGCCGACCGTTGGCGTGACGGCG
GCGAGCCACCTCGTCGGCTCCGGTGGCCACAGCTACTTGGACGTCAGGACAGAAGAGGAA
TTCAAGAAGGGACATGTGGAGAATTCTCTTAATGTGCCATTCCTCTTCTTTACCCCTCAA
GGGAAGGAAAAGAACACAAAGTTCATAGAGCAGGTGGCATTGCATTATGATAAGGAGGAC
AACATAATTGTGGGTTGCCTAAGTGGAGTAAGATCTGAACTAGCATCTGCCGATCTCATA
GCAGCCGGATTCAAAAATGTAAAGAACATGGAAGGAGGTTACATGGCATGGGTGGAAAAT
GGCCTTGCGGTGAATAAACCTCTAGTGCAAGAAGAGCTCTAGTTTCAGTTATTGTATTTT
TAGATAATGACTTTCAGTTATTGTATGACTGGGTGTTAATTTGATTTGTAGAAAGGAAAG
GTATAAGAAAACAATGTTATATTATTCCCC

CDS

462 bp

>Os04t0249600-02 Arsenate reductase, Sulfurtransferase/rhodanese-like protein, Regulation of arsenic accumulation
ATGATGATGATGGTGAGATTGCCTGCTATGTTCGTGATCTGCATCTTGGCTGTTCCGCTG
CTGCCAGCGCTCGGCTCGGAGCCGCCGTCGACACCGGTGCCGACCGTTGGCGTGACGGCG
GCGAGCCACCTCGTCGGCTCCGGTGGCCACAGCTACTTGGACGTCAGGACAGAAGAGGAA
TTCAAGAAGGGACATGTGGAGAATTCTCTTAATGTGCCATTCCTCTTCTTTACCCCTCAA
GGGAAGGAAAAGAACACAAAGTTCATAGAGCAGGTGGCATTGCATTATGATAAGGAGGAC
AACATAATTGTGGGTTGCCTAAGTGGAGTAAGATCTGAACTAGCATCTGCCGATCTCATA
GCAGCCGGATTCAAAAATGTAAAGAACATGGAAGGAGGTTACATGGCATGGGTGGAAAAT
GGCCTTGCGGTGAATAAACCTCTAGTGCAAGAAGAGCTCTAG

Protein

154 aa

>Os04t0249600-02 Arsenate reductase, Sulfurtransferase/rhodanese-like protein, Regulation of arsenic accumulation
MMMMVRLPAMFVICILAVPLLPALGSEPPSTPVPTVGVTAASHLVGSGGHSYLDVRTEEE
FKKGHVENSLNVPFLFFTPQGKEKNTKFIEQVALHYDKEDNIIVGCLSGVRSELASADLI
AAGFKNVKNMEGGYMAWVENGLAVNKPLVQEEL*

CDS

chr04:9673608..9673774 (- strand) : 167 bp

chr04:9673063..9673137 (- strand) : 75 bp

chr04:9672814..9672883 (- strand) : 70 bp

chr04:9672644..9672697 (- strand) : 54 bp

chr04:9671476..9671571 (- strand) : 96 bp

3'UTR

chr04:9671368..9671475 (- strand) : 108 bp

FASTA

>Os04t0249600-02 class=Sequence position=chr04:9671368..9673774 (- strand)
ATGATGATGA TGGTGAGATT GCCTGCTATG TTCGTGATCT GCATCTTGGC TGTTCCGCTG CTGCCAGCGC TCGGCTCGGA
GCCGCCGTCG ACACCGGTGC CGACCGTTGG CGTGACGGCG GCGAGCCACC TCGTCGGCTC CGGTGGCCAC AGCTACTTGG
ACGTCAGGTT GTTGCTCTAT GCCTCTATGC ATCATTATTA GTATTATTCC ATTCTCGGTG TGTCCATAAG TAAGTTAATT
GATTAGCTAA TGGCGCATTG CGACCCACCA ATCTCGAAAT GGACCTGCAA GCCAAGCGAA TCTTGAACCC TTCGCCATAA
GCTTCTGTTA TTTTTTCGTC CCAAATTTCC AGTTCAGGCT TCTGCACATG CGGATTTCGT TTGCGGTTAC CTTGATTCTG
ACATAACCCA GTAATAGGAT CTGCTGCCAA GCTAGATTAC AACCAGTTTC TTGATTTGAC CACACTAGAA TTAATCATCT
CGTAAGGAAT GCAGACGATT TGCCGCCTAT GATGAATATG TTACCCTTCT CAACCCATCC ACCGATTTTT CTTAAAAAAA
ATGGTATATC CACTGATTTC TATGAATTGA AGGACTATCT AGACCGTTTT ATTTTTTAAC CAACTGCCGT TCAACAGGAC
AGAAGAGGAA TTCAAGAAGG GACATGTGGA GAATTCTCTT AATGTGCCAT TCCTCTTCTT TACCCCTCAA GGCAAGATTC
CTTAACTTGC TTCCCTAGTT TTGTCCTGCC CTTCATTATA CATATTTTCT AAGAAAAAAA GATATATCAA GAATTCTTCT
TCCAGGAAAA GAAAACTGCA CACTTTAAGA GTGATATGCC ATTGTTAGCC TGAATTGTAT TACTGATTTA ACCTGTTATT
GAATCATCAG GGAAGGAAAA GAACACAAAG TTCATAGAGC AGGTGGCATT GCATTATGAT AAGGAGGACA ACATAATTGT
GGTATTACTT ATGATTTGTC TATACATATT TAACTAGTAA TATATAAGAC AAAATATCTG GTTTTATATT TATGGACCTT
CATTTAGTTT GTGATTACGT TTGTCCATTT TTTCAAGGGT TGCCTAAGTG GAGTAAGATC TGAACTAGCA TCTGCCGATC
TCATAGCAGC CGTAAGACCT CTCCCCCCTT GAGCGCTCCT GTTGTTTCTA AATCTGATTT ATATATTTTA ACTTAGGACT
TTGATATTCA TAAAATTTTG TAGTAACTTT TTTTAGATAA TGGGAAATTG TTAGAGCAAG TAAGTACGAT ACTTTTTCTC
CTGTGTCCCT CAATTTAAGT AGGTTAAACA TTGTCTGACG GGTGAAAGAC TTGAATAGGT GAACATAGCA TTGAATTTGG
TGGATAATAA TAGTGTTTTA TATGCATGAA AAAGATAGAA TTTGTATGTC AGGCGATTTG CCTAATGCAA TCCTAATTTT
ACTCCTAAAA TTACATTTGA GCAATTTGTG TACTGAATAT TAGAATTTTG CTCCCAACTA AACTTTAATT CCGGTATTGT
TCTTATTTTG TTATGTACAG GTTCTTGGAT ACTGTGACTG TGACCATCGT ACAATCAAAT CGATATAAAA ACACTAATGT
TAATAGTAAA TTAGAATTGA ACGAAATGCA CGCGAAGTTA GCGTAGGCCA TGAGAGATGG ATTGTGGTTT CTCACATAAT
AAAGAGTTAA TTTAATCCAT GCCATTATAA TCAGCAGCAC CTCTTAAACA GTTTGGTAAA GGAATAAGTT CATTTTACAC
CCAGCTTTAA AATGGCTTAT TTAACATATT TGTGTTATGT AGTACTCCCT CTGATCAAGA TTACATGACG TTTCCGACAG
CCAAAACCTA TTAAGCGCAA TTCATTTTGT TTGTTCAAAG CATCAAATAA TATCGTCCGG AGGTAGTACT ATGACAAACA
TACCTTGGAG AAAATTTCCT ACTTGTATTA ATAAAGGAGG AACTTGAGTG TGTATTTACA AGGTATGCCC AGGACACGTG
CACAAAAATA CTGTTCTCAC AAAGTCTGCT TCTTGGTCGC TGCCACTACT CTCTCTGTGA TATCCACATT TTTTTTCTGA
AAGAATAAAT TAGGGTGCAC ATAAGCTTTC ATATTTAACA GTCCCCTTTT TCAGATTCAG TATCTCGATC ATTCCCTTGT
TAGTTTCCTT TGTTTATGTC TCAAACATTT GATATGGAAA CAGGGATTCA AAAATGTAAA GAACATGGAA GGAGGTTACA
TGGCATGGGT GGAAAATGGC CTTGCGGTGA ATAAACCTCT AGTGCAAGAA GAGCTCTAGT TTCAGTTATT GTATTTTTAG
ATAATGACTT TCAGTTATTG TATGACTGGG TGTTAATTTG ATTTGTAGAA AGGAAAGGTA TAAGAAAACA ATGTTATATT
ATTCCCC

Locus: Os04g0249600

Loading...

Locus: Os04g0249600

Loading...