Os04t0290800-00

Locus

Os04g0290800

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RUS1

CGSNL Gene Name

ROOT UV-B SENSITIVE 1

Oryzabase Gene Symbol Synonym(s)

OsRUS1

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK250329 (DDBJ)

Protein Evidence

NP_190175.2 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Protein of unknown function DUF647 (IPR006968)

Expression Databases

TENOR (Os04t0290800-00)

Others

Oryzabase (21447)

KEGG (Os04t0290800-00)

Transcript

2245 bp

>Os04t0290800-00 Similar to predicted protein.
GCCGGTCGCCTCCATCGCTGCAAACCCCTCCTCCTCCTCCGCCGCCGCCGCCGGCGGCCA
TAACCAAACCGCTCCTCCGAGATGTCCTCCTCGCAATCTCTCCTCCTCCTCGCGGCCCCT
CTCTCCCCACCCACCCTTCCCCGCCTCGTTCCCCCTCCTCCCACCTCCGCTCCCCGCCTC
CCCCGCCTCGCCGCCAACCTCTCCCGCCCGCCACCCCTCGCGATCTCCTCTCCTGGCTGT
GATGGCGGTGGTGGTGGCGGAGGAGGAGGAGGAGGAGGTGGGTGGTGGAGGCAAGGGGGG
AGTGGCCCTCCTGACCCCGGCGACGGGTGGTGGCGGTGGCTCCAGTCGCTCCACCCCGAG
CTCCTCCTCCTCTTCGTGCTCCTCCACTCGGGCGCCTTCGCCGCCATCCCGGCCGCGCTC
GCCGAGGCCATCGGCGGTAGCGGCGGCAGGGAGGGAGCGAGCGTCTGGGAGGTGAGGGGC
GGTGCGCGCACGCTGCTCGTGCCGGACCCGACCGGGACCTCCTACGTCGTCGCGGGAGAC
GGGAGGCGGAAGCAGGCGGAGGGGGAGGATGCGGAGAAGGCCGGTGCCGGCCGTGCCGAG
CTGGCTGCGCTGCGGCGCCAGCTGGAGCTGTCGTGGCGGCGGTGCGCCACGGTCGCCGTT
CAGCTGCTGCTCCCGGATGGGTACCCTGACAGCGTGAGCAGCGACTACCTGCAGTACTCG
CTGTGGCGCGGCGTGCAGGGCATCGCCAGCCAGATCAGTGGCGTGCTCTCGACGCAGGCA
TTGTTGTATGCGGTTGGATTGGGGAAAGGCGCTATACCTACCGCGGCAGCGGTGAATTGG
GTGCTGAAGGATGGGTTGGGGTACCTGAGCAAGATATTGCTATCGAAATTCGGCCGGCAT
TTCGATGTTAACCCAAAGGGGTGGCGATTGTTCGCCGATCTTCTGGAGAACACGGCTTAT
GGGCTGGAGATTTTAACTCCGGTCTTTCCTCACCTGTTTGTTCCAATTGGGGCTGCCGCT
GGAGCTGGTCGATCAGCAGCTGCTTTGATACAGGCTGCCACCAGGAGTTGTTTCTATGCT
GGATTTGCTGTGCAAAGGAACTTTGCTGAGGTCATTGCAAAGGGTGAGGCACAAGGAATG
GTCAGCAAATTCCTGGGGATAATGCTAGGGATAGCATTAGCTAATCGCATTGGCTCTTCT
GTATCATTAGCTCTTATTTCATTTGCTGGAGTTACTGCAGTTCACATGTATTGCAACCTC
AAGTCTTATCAATCGATTCAGCTGAGGACACTGAATCCTTATCGTGCAAGTTTGGTGTTC
AGTGAGTATCTATTGAGTGGACAAGTTCCTTCAGTCAAAGAGGTTAACGACGAGGAACCC
CTTTTCCTGAATCTATCTATTGGTACTTCACGTAAAGAAAGCAAGATTTTGTCACCACAG
GCAAAAGATGCTGCAGAAATAATTTGTCGGCGGTTGCAGTTGGGTTCTAAACTTAGTGAA
ATAATTGAGAACAAGGAAGATGCATGCGCATTGTTTGATCTCTACAAAAACGAACAATAC
CTTCTTACAGAATACAAGGGAAAATTTTGTGTCATCCTTAAAGAGGGATCTTCTCCTGAA
GATATGCTCAAATCTTTATTCCATGTTAACTATCTCTATTGGTTGGAGAAATATCTGGGC
ATCAAACCAAGTGATGTTGCCTCAGCGTGTAGACCTGGTGGAAGGCTTGAAGCATCACTC
GATTATACTCAAAGAGAATTTAGCCATGTCAAACTTGATGGTTCAAATGGTGGCTGGGTG
ATGGATGGTCTGATTGCTAGACCGCTACCCGTAAGAATACGCATAGGAGATGCTCCTTCA
TAAAACTTCTCAACTTGTTTTGCTCACATCGACGCCGCTAGAATGTGTACAGTGGGTTCA
TTCTTTGGGCAATTTCTGAGACCTTCGCGTCGGGAGTCATGGGGTGATTTGGCATCTTAT
TAACAAGCGTCTGTGAACATATAGTCTTCAATTGTTTGGACACATGATCTAACCATAAGA
GTTTACAATCAAGTTCTCATAAGATTGGAGCTGGTTATGTCTTTTTTTTTTTCATTTGAA
TGTAGGGTGTTTAGTTTGTCGACATTCATGTCATGTAGTGGTTGCTCAGGAAACCAACAG
CACTTCTTGGACAGTAATAGAGAATTAGAGATAAAGACTAACCAGAGCTATGCTTGAGGC
AAGTACTTCTGATTATAGTTGGCTA

CDS

1782 bp

>Os04t0290800-00 Similar to predicted protein.
ATGTCCTCCTCGCAATCTCTCCTCCTCCTCGCGGCCCCTCTCTCCCCACCCACCCTTCCC
CGCCTCGTTCCCCCTCCTCCCACCTCCGCTCCCCGCCTCCCCCGCCTCGCCGCCAACCTC
TCCCGCCCGCCACCCCTCGCGATCTCCTCTCCTGGCTGTGATGGCGGTGGTGGTGGCGGA
GGAGGAGGAGGAGGAGGTGGGTGGTGGAGGCAAGGGGGGAGTGGCCCTCCTGACCCCGGC
GACGGGTGGTGGCGGTGGCTCCAGTCGCTCCACCCCGAGCTCCTCCTCCTCTTCGTGCTC
CTCCACTCGGGCGCCTTCGCCGCCATCCCGGCCGCGCTCGCCGAGGCCATCGGCGGTAGC
GGCGGCAGGGAGGGAGCGAGCGTCTGGGAGGTGAGGGGCGGTGCGCGCACGCTGCTCGTG
CCGGACCCGACCGGGACCTCCTACGTCGTCGCGGGAGACGGGAGGCGGAAGCAGGCGGAG
GGGGAGGATGCGGAGAAGGCCGGTGCCGGCCGTGCCGAGCTGGCTGCGCTGCGGCGCCAG
CTGGAGCTGTCGTGGCGGCGGTGCGCCACGGTCGCCGTTCAGCTGCTGCTCCCGGATGGG
TACCCTGACAGCGTGAGCAGCGACTACCTGCAGTACTCGCTGTGGCGCGGCGTGCAGGGC
ATCGCCAGCCAGATCAGTGGCGTGCTCTCGACGCAGGCATTGTTGTATGCGGTTGGATTG
GGGAAAGGCGCTATACCTACCGCGGCAGCGGTGAATTGGGTGCTGAAGGATGGGTTGGGG
TACCTGAGCAAGATATTGCTATCGAAATTCGGCCGGCATTTCGATGTTAACCCAAAGGGG
TGGCGATTGTTCGCCGATCTTCTGGAGAACACGGCTTATGGGCTGGAGATTTTAACTCCG
GTCTTTCCTCACCTGTTTGTTCCAATTGGGGCTGCCGCTGGAGCTGGTCGATCAGCAGCT
GCTTTGATACAGGCTGCCACCAGGAGTTGTTTCTATGCTGGATTTGCTGTGCAAAGGAAC
TTTGCTGAGGTCATTGCAAAGGGTGAGGCACAAGGAATGGTCAGCAAATTCCTGGGGATA
ATGCTAGGGATAGCATTAGCTAATCGCATTGGCTCTTCTGTATCATTAGCTCTTATTTCA
TTTGCTGGAGTTACTGCAGTTCACATGTATTGCAACCTCAAGTCTTATCAATCGATTCAG
CTGAGGACACTGAATCCTTATCGTGCAAGTTTGGTGTTCAGTGAGTATCTATTGAGTGGA
CAAGTTCCTTCAGTCAAAGAGGTTAACGACGAGGAACCCCTTTTCCTGAATCTATCTATT
GGTACTTCACGTAAAGAAAGCAAGATTTTGTCACCACAGGCAAAAGATGCTGCAGAAATA
ATTTGTCGGCGGTTGCAGTTGGGTTCTAAACTTAGTGAAATAATTGAGAACAAGGAAGAT
GCATGCGCATTGTTTGATCTCTACAAAAACGAACAATACCTTCTTACAGAATACAAGGGA
AAATTTTGTGTCATCCTTAAAGAGGGATCTTCTCCTGAAGATATGCTCAAATCTTTATTC
CATGTTAACTATCTCTATTGGTTGGAGAAATATCTGGGCATCAAACCAAGTGATGTTGCC
TCAGCGTGTAGACCTGGTGGAAGGCTTGAAGCATCACTCGATTATACTCAAAGAGAATTT
AGCCATGTCAAACTTGATGGTTCAAATGGTGGCTGGGTGATGGATGGTCTGATTGCTAGA
CCGCTACCCGTAAGAATACGCATAGGAGATGCTCCTTCATAA

Protein

594 aa

>Os04t0290800-00 Similar to predicted protein.
MSSSQSLLLLAAPLSPPTLPRLVPPPPTSAPRLPRLAANLSRPPPLAISSPGCDGGGGGG
GGGGGGGWWRQGGSGPPDPGDGWWRWLQSLHPELLLLFVLLHSGAFAAIPAALAEAIGGS
GGREGASVWEVRGGARTLLVPDPTGTSYVVAGDGRRKQAEGEDAEKAGAGRAELAALRRQ
LELSWRRCATVAVQLLLPDGYPDSVSSDYLQYSLWRGVQGIASQISGVLSTQALLYAVGL
GKGAIPTAAAVNWVLKDGLGYLSKILLSKFGRHFDVNPKGWRLFADLLENTAYGLEILTP
VFPHLFVPIGAAAGAGRSAAALIQAATRSCFYAGFAVQRNFAEVIAKGEAQGMVSKFLGI
MLGIALANRIGSSVSLALISFAGVTAVHMYCNLKSYQSIQLRTLNPYRASLVFSEYLLSG
QVPSVKEVNDEEPLFLNLSIGTSRKESKILSPQAKDAAEIICRRLQLGSKLSEIIENKED
ACALFDLYKNEQYLLTEYKGKFCVILKEGSSPEDMLKSLFHVNYLYWLEKYLGIKPSDVA
SACRPGGRLEASLDYTQREFSHVKLDGSNGGWVMDGLIARPLPVRIRIGDAPS*

5'UTR

chr04:12645868..12645948 (+ strand) : 81 bp

CDS

chr04:12645949..12646644 (+ strand) : 696 bp

chr04:12646750..12647025 (+ strand) : 276 bp

chr04:12647754..12647810 (+ strand) : 57 bp

chr04:12649060..12649258 (+ strand) : 199 bp

chr04:12650362..12650468 (+ strand) : 107 bp

chr04:12650681..12650854 (+ strand) : 174 bp

chr04:12650939..12651211 (+ strand) : 273 bp

3'UTR

chr04:12651212..12651293 (+ strand) : 82 bp

chr04:12651349..12651648 (+ strand) : 300 bp

FASTA

>Os04t0290800-00 class=Sequence position=chr04:12645868..12651648 (+ strand)
GCCGGTCGCC TCCATCGCTG CAAACCCCTC CTCCTCCTCC GCCGCCGCCG CCGGCGGCCA TAACCAAACC GCTCCTCCGA
GATGTCCTCC TCGCAATCTC TCCTCCTCCT CGCGGCCCCT CTCTCCCCAC CCACCCTTCC CCGCCTCGTT CCCCCTCCTC
CCACCTCCGC TCCCCGCCTC CCCCGCCTCG CCGCCAACCT CTCCCGCCCG CCACCCCTCG CGATCTCCTC TCCTGGCTGT
GATGGCGGTG GTGGTGGCGG AGGAGGAGGA GGAGGAGGTG GGTGGTGGAG GCAAGGGGGG AGTGGCCCTC CTGACCCCGG
CGACGGGTGG TGGCGGTGGC TCCAGTCGCT CCACCCCGAG CTCCTCCTCC TCTTCGTGCT CCTCCACTCG GGCGCCTTCG
CCGCCATCCC GGCCGCGCTC GCCGAGGCCA TCGGCGGTAG CGGCGGCAGG GAGGGAGCGA GCGTCTGGGA GGTGAGGGGC
GGTGCGCGCA CGCTGCTCGT GCCGGACCCG ACCGGGACCT CCTACGTCGT CGCGGGAGAC GGGAGGCGGA AGCAGGCGGA
GGGGGAGGAT GCGGAGAAGG CCGGTGCCGG CCGTGCCGAG CTGGCTGCGC TGCGGCGCCA GCTGGAGCTG TCGTGGCGGC
GGTGCGCCAC GGTCGCCGTT CAGCTGCTGC TCCCGGATGG GTACCCTGAC AGCGTGAGCA GCGACTACCT GCAGTACTCG
CTGTGGCGCG GCGTGCAGGG CATCGCCAGC CAGATCAGTG GCGTGCTCTC GACGCAGGTA CGGTTGTGGC GCCTGAGCCG
CGTCCATCTG TGTGCAATTC ACCGGCTATT AGTTGAAATG TGCCATTTTC GATTGGTGAA TTTGTGTATT TATCCTGTCT
AGGCATTGTT GTATGCGGTT GGATTGGGGA AAGGCGCTAT ACCTACCGCG GCAGCGGTGA ATTGGGTGCT GAAGGATGGG
TTGGGGTACC TGAGCAAGAT ATTGCTATCG AAATTCGGCC GGCATTTCGA TGTTAACCCA AAGGGGTGGC GATTGTTCGC
CGATCTTCTG GAGAACACGG CTTATGGGCT GGAGATTTTA ACTCCGGTCT TTCCTCACCT GTTTGTTCCA ATTGGGGCTG
CCGCTGGAGC TGGTCGATCA GCAGCTGCTT TGATACAGGT CAGAACTGTT GATTTTGATA TGGATTGTCA TTGTTGCTGT
ACCCCTTCAC CTGTGCAGAC CATATTTACC CATTTCATGC TGGAAAATGC AAACCATATG CGCAAGGTCA TATTGTTTCA
TGTGAAATCT GCTGCAGCAT GTCATTTTCT TCGTATTATG TTCCACCTAC AGATTTGGTC AGCATTGTTC AGATTACACT
TAGTATGGAA ACATGTGTCA TCCAAATTTG TAGTTAGGTA TCATATTTTG GCATTAATCA TACACTGAAT TGAACGTGCA
ATATCATTCT GGTAGTCCAG TTTTTTTGGG ATATTTTCCA ATATATTATC TCCTCCTGAC AGATCTGTAC TGCTTGTTCG
GCTTTCTTGA TTCTTCCCCT GTTTTTGCCT TGTCTCCTGA ATCTTGCTCA CTACATAAAG AACATAATAA CTGAAGATAT
CCTGCTTCTA ATCATGTCCT GCATACCTCT TCACTGAAAT TCTACTGGAT GCAATGGATA AATCAGTAAA TTGGCATGGA
TAGGTGGCAG ATGGTATGAC CGAATTATGG GTGATTTGAA ATGTTGCTTA CTCTTGTGGA ATGCTTTGAA ATTATTACTC
TATTCTGCAA ATTTGAGCCT GACTGCCTAT GAATTGATTT TTATGGTGCT TCCCAACAAT ATTTTGTACT TGCCAATTCA
TTATTTTTCT TTGAACCACT ATTAGTGCAA TGATTCAATT CTGTAGGCTG CCACCAGGAG TTGTTTCTAT GCTGGATTTG
CTGTGCAAAG GAACTTTGCT GAGGTAAAAT CAATCTATCC TCATTCATGA AAACAAATCG TTTAGCATGT AGATGTCATT
GTTAGAATAA TTTTTGTTTC TCATGTATGA GCCTTGCAAT CTATATCCAA TCCTACGGGT AAGCTGCAGT TATATCAGAT
ATTGCTGATA CTATTTTTAC GCAAGAAAAT ATATACCATT GCGAACCTTT AATGTTCTGA AAAGATGCCA CTGTACTTTT
TATTTTGCTC ACACTGGACC AAATTACTCC TACCTCCTGG TCTTGTTCTC TGCCTTTTGC TATGACAGCA TTGTGTGGAC
TATAGCATTG GTAGCAAGTT TGTCTTTGTT GCTGAATTGA TGACTTCCGC TCCTGGATTG CATGCATGCA CCACCTTTGT
TTGCTGCTCT CCATTTTTTT TCTTCGTTTG ATGTCCTTTT CACAGTTCAC TATATTGCCT GCACCAGGAA TCCTCATTCT
TTCCTATTGG GTATATACAT TACAATTATA AACCCCACAG GCAGCGGTTC GGTACATAGG TATAATTGCA TCGCCCTTGT
GACCATGTCA ATTTTTTTTT TTTGGGTTAA GTTTCAATTT TGACCCTTTT TTCTCATCGA AGTGGCACTT TGGACAAGGT
TTTACAAATT TTATCATTGG ACCAGTGGCC CAACCGTCCG CGAGAAAAAA TGGGAGTGGC ATCGTTTAGT GGTGATGGTG
TGGCATCAAT GAGGAAGCCG TGAAGCAGGT GATGGCAGGG GCAGCATCAC GACACCAAGG TGCACCCTGT TGAGGTCCAG
TTGAGGATGC TACACCTGAA ATCAGGGAGT GCCTGTTTGC TTCAGTGATG CTGGTGGTGG TTGCCTAATG TGAGATATTG
AGCATGTGTG CTAAGAGCCT AAGAGTTGTT AAGGAGCCAA TCTAGTTTTC ACACGAGGAC AAGCATGTTA GCATCAACTG
CAAGGTGCTT AATGTGTAAG GAACTAAGGA CGATGTGGAT GCAAGGCACA CTTGCACATG GACCAGTCAT CTAAAGTGCA
ACTGTTTGGT AACAAAACCT GGTTCGAACT TCGAAGTGAT AAAACTTTTC AAAACTTTGT CCAAATGCCC TAGATTTTTT
ACTCTGTGCC CGTGTTGTAT TCTTATGAGG GATTCTTTTT TTTTTTTTAG AAATTGAACT TTTAAATTCT TAAATTTAGT
CAATTCAACC TACGCATCCC ACTTTGCATT CTGACCCAAG TAGTTAAATA CCAATTGGAT CTTACATTTC AGGTCATTGC
AAAGGGTGAG GCACAAGGAA TGGTCAGCAA ATTCCTGGGG ATAATGCTAG GGATAGCATT AGCTAATCGC ATTGGCTCTT
CTGTATCATT AGCTCTTATT TCATTTGCTG GAGTTACTGC AGTTCACATG TATTGCAACC TCAAGTCTTA TCAATCGATT
CAGCTGAGGA CACTGAATCC TTATCGTGCA AGTAATGTTT TATCCACTGC TGCTTATCCC GTTCAGTAGT TCCTTTATAA
CCTTCATATG ATCACAACTC ACAATTTTTA TATGAATAAT GTTGTTTAAT TGATGTTCAA ACACAAATAA ACTGGTGGAT
GGATCAATAT ATTAACAATA CATACAAATA CCAAAACTGC ACTGTAGCTG ATTGAACTCA GCAAAACATC ACACGATTTT
TTTTTTAAAA AAATCACGTT TTGTCACTAT TCTTTTGGGT AAATATCGAT ATCTCCCTTG CAATGATAGC CTGCAAAATT
GTCCATTGTA AGTGCATGGC AGTTGTCACT GAACATGTGT ATGTTTTTCT AGAATTGATG GTTGAAATCA TATTTTGAAT
TGTAATTTTT TTGAATGGAT GATTGAAAAC TCGTGAGGTC TTGATGGTCA GCTTTGCACA GTATACATTG TAATATAAAA
TGGACTACTC TGTAGATTAA ATTGGCAGTC AATTAGGAAT CAATCCAACA GCACTGAAAG AAGGGTATTT GCATTAGCAA
AGTCATGCCA GATATCTGGT TTTAACTTTA CTGATCCAAC GATCAGATTA ATGATGTTGT GGCTCCGCGT GAGATGAGAC
AGCAAGGAGA GGGATTTTGC TGGAGCTAAT CTGTGAAAAA TCTTGGTCAC TTGTGTTTTC CAGATTATTT AGTGTCTTGG
TTTGCTGTGG ATGAGAGATG GCATTGACTA CAGCTAGGCT TAGCCTCTGT TTGCAGTTTG TTGTGTTGTG ATAAATGTGT
GTCTTTTCTA AGTCATCTAG AAATGTAAAT ATATAATCAT TGTAGATTAT TTTATTAATC ATTTTAAGGT TAAGACAATT
ATGCAACTTT CATTCCCACA AAACTTCCAA CTTTTTAGTA GGTATTAATA TTACCGTTTG TAACTTAGAT TATCAGAATT
CACCTCAATG GCATACGGAG CCTTAGTGAG GATTAATTGC ATAAGTGGCC TCTCGCAAGG CAGCAATTGT GTCATAAAAT
CATCCAGTTT TAGTGGGATT ATTCTGTCTT TCCTTGGTTT TCATTACTAA TCGATAAGAT TAACTAATTT ATCTGCCGCC
CTCCTGTCTC ACAGGTTTGG TGTTCAGTGA GTATCTATTG AGTGGACAAG TTCCTTCAGT CAAAGAGGTT AACGACGAGG
AACCCCTTTT CCTGAATCTA TCTATTGGTA CTTCACGTAA AGTAAGTAAA GTATTTTTCT AACATCAAAT CACTGATACT
TTTTGTCCTC TATATTTTCA TATTGTTGAG GTCTTACAGC CTCCCATTCC CAAGGCACGC TTTAACTAGT CAAGAGTTAA
CTGCAACTTA ATACATCTTA AATTCACAAT ATGTGCCATT CTTGCACTTA TTTATGTGTC CCACTATATG TGGTTCCTTG
AATTTTGTAC CAGGAAAGCA AGATTTTGTC ACCACAGGCA AAAGATGCTG CAGAAATAAT TTGTCGGCGG TTGCAGTTGG
GTTCTAAACT TAGTGAAATA ATTGAGAACA AGGAAGATGC ATGCGCATTG TTTGATCTCT ACAAAAACGA ACAATACCTT
CTTACAGAAT ACAAGGGAAA ATTTTGTGTG AGTTTATCTT GAACCAAGCA GTTTCAAGAT GCCATTCTGC TATCATACAA
AGTTACTGAC ATTTTACCCT TTGATTTACA GGTCATCCTT AAAGAGGGAT CTTCTCCTGA AGATATGCTC AAATCTTTAT
TCCATGTTAA CTATCTCTAT TGGTTGGAGA AATATCTGGG CATCAAACCA AGTGATGTTG CCTCAGCGTG TAGACCTGGT
GGAAGGCTTG AAGCATCACT CGATTATACT CAAAGAGAAT TTAGCCATGT CAAACTTGAT GGTTCAAATG GTGGCTGGGT
GATGGATGGT CTGATTGCTA GACCGCTACC CGTAAGAATA CGCATAGGAG ATGCTCCTTC ATAAAACTTC TCAACTTGTT
TTGCTCACAT CGACGCCGCT AGAATGTGTA CAGTGGGTTC ATTCTTTGGG CAATTTCTGA GACCTTGTCA TCATATCACA
AATAATTTGG ACGCTTTCTC CAGTGAAGGA AAACAGGCCA GCGCGTCGGG AGTCATGGGG TGATTTGGCA TCTTATTAAC
AAGCGTCTGT GAACATATAG TCTTCAATTG TTTGGACACA TGATCTAACC ATAAGAGTTT ACAATCAAGT TCTCATAAGA
TTGGAGCTGG TTATGTCTTT TTTTTTTTCA TTTGAATGTA GGGTGTTTAG TTTGTCGACA TTCATGTCAT GTAGTGGTTG
CTCAGGAAAC CAACAGCACT TCTTGGACAG TAATAGAGAA TTAGAGATAA AGACTAACCA GAGCTATGCT TGAGGCAAGT
ACTTCTGATT ATAGTTGGCT A

Locus: Os04g0290800

Loading...

Locus: Os04g0290800

Loading...