Os04t0304400-01

Locus

Os04g0304400

Description

MADS-box transcription factor, Homologue of the AGL17-clade MADS-box genes, Regulation of root system development via auxin signalling

RAP-DB Gene Symbol Synonym(s)

OsMADS25

RAP-DB Gene Name Synonym(s)

MADS box gene25, MADS-box transcription factor 25

CGSNL Gene Symbol

MADS25

CGSNL Gene Name

MADS BOX GENE 25

Oryzabase Gene Symbol Synonym(s)

OsMADS25

Oryzabase Gene Name Synonym(s)

MADS box gene25, MADS-box transcription factor 25

Transcript Evidence

AK102927

Protein Evidence

Q84NC5

Literature

PMID: 29932274

Note

Manual Curation

August 1, 2018

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Biological Process: positive regulation of transcription by RNA polymerase II (GO:0045944)

Molecular Function: RNA polymerase II regulatory region sequence-specific DNA binding (GO:0000977)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Molecular Function: protein dimerization activity (GO:0046983)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Transcription factor, MADS-box superfamily (IPR036879)

Transcription factor, MADS-box (IPR002100)

MADS MEF2-like (IPR033896)

Transcription factor, K-box (IPR002487)

Full-length cDNA

J033114E21 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0304400-01)

RiceXPro (AK102927)

Others

Oryzabase (3091)

KEGG (Os04t0304400-01)

Transcript

1102 bp

>Os04t0304400-01 MADS-box transcription factor, Homologue of the AGL17-clade MADS-box genes, Regulation of root system development via auxin signalling
GCTATACGCATCTTCCCTAGCTTGCTAAGCTAGCTAGTCTTCTCCTTCCTTTCTCCTCTT
CCTCCTCCTCCTCTTCTTCTCAATCTTGCTCAGCAAATCTTGTCGGGGAGAGAGAGAGAG
AGATCAGCAAGGAGAAGAGGGAATTAAGCTAGATCGAGGTAGTCGTCGATCGATCGATTG
AAGATGGGGAGAGGGAAGATTGCCATCAAGAGGATCGACAACACGATGAACCGGCAGGTG
ACCTTCTCGAAGCGGCGCGGCGGGCTGATGAAGAAGGCCCGGGAGCTGGCCATCCTCTGC
GACGCCGACGTCGGCCTCATTGTCTTCTCCTGCACCGGCCGCCTCTACGACTTCTCCAGC
TCAAGCATGAAATCAATAATAGAGCGGTACCAGGAGGCAGGAGAGGAGCATTGTCGGTTG
CTGAACCCAATGTCAGAGGCTAAGTTTTGGCAGCGGGAGGTTACAACTTTGAGGCAGCAA
GTGCAAAACTTACACCACAACAACAGGCAACTTTTGGGAGAGGAAATCTCCAACTTCACA
GTTAGAGATCTGCAGCTTCTCCAGAACCAAGTTGAGATGAGCCTACATTCCATAAGAAAT
AAAAAGGATCAACTTTTGGCAGAGGAGATTCTAAAACTCAATGAAAAGGGGTCTCTTGTT
CAAAAGGAGAACAGTGAACTTCGCAAGAAGTTCAACATTGCTCATCAACGCAACATAGAA
TTACACAAGAAGCTTAACTCTGGAGAAAGCACGTCAAGTGAGCAAGTTACCAGAAGCTCA
AAGGATCCCGGAGAATCGAGTACACCCCGTGATTCACGTGTGTGTATTGACCTTGAATTG
AGTCAAAAAGAAGTTGAAGATGAATAACACATGATCAAGTGTTAAAAACAACATGATGGC
CAGTAACTTTTGCAGCATCACGCCTACTACAAGCGCAAGAAAAGCTAGCTACTACTGGAA
CAAGGGATCTTAATCATGTTTTGAAACTTAATTAGTAATATTTTAAAAAATCGTACTATA
CTAATCATGATGTGTAGCGTATTGCACCACTGAATTTATTACTGTAATTAACATGGTGAG
TGTTAAAATATTTTGTGATATC

CDS

684 bp

>Os04t0304400-01 MADS-box transcription factor, Homologue of the AGL17-clade MADS-box genes, Regulation of root system development via auxin signalling
ATGGGGAGAGGGAAGATTGCCATCAAGAGGATCGACAACACGATGAACCGGCAGGTGACC
TTCTCGAAGCGGCGCGGCGGGCTGATGAAGAAGGCCCGGGAGCTGGCCATCCTCTGCGAC
GCCGACGTCGGCCTCATTGTCTTCTCCTGCACCGGCCGCCTCTACGACTTCTCCAGCTCA
AGCATGAAATCAATAATAGAGCGGTACCAGGAGGCAGGAGAGGAGCATTGTCGGTTGCTG
AACCCAATGTCAGAGGCTAAGTTTTGGCAGCGGGAGGTTACAACTTTGAGGCAGCAAGTG
CAAAACTTACACCACAACAACAGGCAACTTTTGGGAGAGGAAATCTCCAACTTCACAGTT
AGAGATCTGCAGCTTCTCCAGAACCAAGTTGAGATGAGCCTACATTCCATAAGAAATAAA
AAGGATCAACTTTTGGCAGAGGAGATTCTAAAACTCAATGAAAAGGGGTCTCTTGTTCAA
AAGGAGAACAGTGAACTTCGCAAGAAGTTCAACATTGCTCATCAACGCAACATAGAATTA
CACAAGAAGCTTAACTCTGGAGAAAGCACGTCAAGTGAGCAAGTTACCAGAAGCTCAAAG
GATCCCGGAGAATCGAGTACACCCCGTGATTCACGTGTGTGTATTGACCTTGAATTGAGT
CAAAAAGAAGTTGAAGATGAATAA

Protein

228 aa

>Os04t0304400-01 MADS-box transcription factor, Homologue of the AGL17-clade MADS-box genes, Regulation of root system development via auxin signalling
MGRGKIAIKRIDNTMNRQVTFSKRRGGLMKKARELAILCDADVGLIVFSCTGRLYDFSSS
SMKSIIERYQEAGEEHCRLLNPMSEAKFWQREVTTLRQQVQNLHHNNRQLLGEEISNFTV
RDLQLLQNQVEMSLHSIRNKKDQLLAEEILKLNEKGSLVQKENSELRKKFNIAHQRNIEL
HKKLNSGESTSSEQVTRSSKDPGESSTPRDSRVCIDLELSQKEVEDE*

5'UTR

chr04:13672710..13672892 (+ strand) : 183 bp

CDS

chr04:13672893..13673074 (+ strand) : 182 bp

chr04:13673667..13673745 (+ strand) : 79 bp

chr04:13673960..13674021 (+ strand) : 62 bp

chr04:13674411..13674510 (+ strand) : 100 bp

chr04:13674600..13674641 (+ strand) : 42 bp

chr04:13674774..13674857 (+ strand) : 84 bp

chr04:13674959..13675093 (+ strand) : 135 bp

3'UTR

chr04:13675094..13675116 (+ strand) : 23 bp

chr04:13675673..13675884 (+ strand) : 212 bp

FASTA

>Os04t0304400-01 class=Sequence position=chr04:13672710..13675884 (+ strand)
GCTATACGCA TCTTCCCTAG CTTGCTAAGC TAGCTAGTCT TCTCCTTCCT TTCTCCTCTT CCTCCTCCTC CTCTTCTTCT
CAATCTTGCT CAGCAAATCT TGTCGGGGAG AGAGAGAGAG AGATCAGCAA GGAGAAGAGG GAATTAAGCT AGATCGAGGT
AGTCGTCGAT CGATCGATTG AAGATGGGGA GAGGGAAGAT TGCCATCAAG AGGATCGACA ACACGATGAA CCGGCAGGTG
ACCTTCTCGA AGCGGCGCGG CGGGCTGATG AAGAAGGCCC GGGAGCTGGC CATCCTCTGC GACGCCGACG TCGGCCTCAT
TGTCTTCTCC TGCACCGGCC GCCTCTACGA CTTCTCCAGC TCAAGGTTGG TGATTATCAT CGTCGATCCC CTTCTATAGT
TCTATATGTA TATAGCTGCT ACCTGCTAGG TCATGAAATA TATCCCAATC CTTCAGATTT TTGTCTATAT ATCTCGATGT
GTCCAGCTAT CTAGCTTTTG CTTTACTCTA GCTTAGGGTT TTCTTTGATT CTTTGGATGA TCTTAAGGTG AAAGACTTCT
GTTTTTTTTA GAAAAAAATA AAGAAAATCG ATGCATCCAT TTAGATCACT CCTTCTCCCA TCTAAATAAT CTCTATACAC
TATTAATTTG ATGAATTGTG TATGCATATA TTGACTCTTT CTGTTTAGTC TGGAGCATTA TTCCTGAAAG AGAAGGAGAT
GCGCAGTAGG AGCTGGTATG CAAGGGGCTG CCAGAATGTG AGAATATATT TCTAGAAATG GTGTATACGA TTTTTCTAAG
TTAAATAACT CACAAGTTAT CTCTAGATAT ATATTTATTT TGATTTGTAT ATTAATTTAC CTCGTTTCTT AGCTGAAAAT
TTAGGTTAAT TTCCCCTAGA TGCATAAAAC ATTTGCTATA TATTGGATCG TAATGGTATA GTCTTCCTTT TTGTTAGCAT
GAAATCAATA ATAGAGCGGT ACCAGGAGGC AGGAGAGGAG CATTGTCGGT TGCTGAACCC AATGTCAGAG GCTAAGGTAT
GCATTCTAAT ATAATGGTAG CAAATTTGAG GTAAATTAAA AATTCATTTC TTGAGGTCAT CTGGTTTTGC ATACAGCTAC
AAAAGTTGTT GACTAAATTG CCGCACTTTG TCGTCATAAA CTCCATTTTC CCAATTCTTA ACTAAAATTC CTATATATTC
CAATGTCATT ATTTGCAATT ATCCTGACAT TTCTACTTAT GTATTGGCAG TTTTGGCAGC GGGAGGTTAC AACTTTGAGG
CAGCAAGTGC AAAACTTACA CCACAACAAC AGGTAAAATC AAGTCCAATG TCAATGATAT ATTACACATA CAACCATAGC
TAATTACACA CCTCTTCTCA AGTTTTTTTT TTACCCAAAT CTTAGCATAA CCAGATGAAC TCAAGAAATG AAGTCCCCCG
CCTGGGAAAA TGCTTTCTCT AGTAGTGATG TTGACCTCAC TTTCTCTCTA AATTAGTTTT TACTTGTCTG CAAACTATTT
AAACGAAAAC AGTGCATACT ACTTTATTAG GATCAACCAA TATGAAGGTG AAAATGAAAT CTTTTTTAAG GCCCATGTGG
AAATTCATGT TTCAAATAAA AGGTGAAAAT ACCTTTTAAT GCATGATTAA TTCTACGTGC TATCAATTCT AGTCACATTC
TTATATGACG TACACTGATA GGCAACTTTT GGGAGAGGAA ATCTCCAACT TCACAGTTAG AGATCTGCAG CTTCTCCAGA
ACCAAGTTGA GATGAGCCTA CATTCCATAA GAAATAAAAA GGTATAATAT TGATAATACC CTTTTCTCGA CTAATAAATA
AATAATCTTT TCCTAATTAA ATGGCGATAT ATCTATTGTC TCTTTACTAG GATCAACTTT TGGCAGAGGA GATTCTAAAA
CTCAATGAAA AGGTTGTACT TGCATCTTCT TCTTCTTGAT GAAATAGCTC ATGATTTAAT TGGTATCAGT TCTTACATCT
ATACACTGTT CATGATTGAG GTAAAATTAC ACGAATATAT ATCGCTCTAT ACTTTTAATT GTAGGGGTCT CTTGTTCAAA
AGGAGAACAG TGAACTTCGC AAGAAGTTCA ACATTGCTCA TCAACGCAAC ATAGAATTAC ACAAGAAGGT AAAGTTTCTA
TTCGATCTAC TCGAAACATA CAAAAATGTC GTAGAATATT ATTGATATAT AAATATACAA TTTACATCAT CTTGATTAAT
TAATTTCAGC TTAACTCTGG AGAAAGCACG TCAAGTGAGC AAGTTACCAG AAGCTCAAAG GATCCCGGAG AATCGAGTAC
ACCCCGTGAT TCACGTGTGT GTATTGACCT TGAATTGAGT CAAAAAGAAG TTGAAGATGA ATAACACATG ATCAAGTGTT
AAAAACAGTG AGTTTTCAAA TCTTTAATTA CGTAAACCGT AAAACCTCGC TCTTGTAACT AATATATATT TCTTCAATGT
TTAATCAAAG TTGTCAGAGT TCCTTACCTT TTGCTAGTAT CACAAAACAA GTAGCTATTT GTTTGTGATA CTAGCTAGTA
ATTTGTGTTA AGCTAGCTAG TAACTTGTGT TAAACTAGCT ATATAAATTA AGTCACAAAA TACCCATAAA TTAAGCTAGC
TAGCCCTTCA AATTTTGTTG TTTTTCTCTG ATTAGTTAAT ACTATGGTTT CTAGCTAGCT AGCTAGCTAG CCCTTCAAAT
TAAGCACTGT ACAGAACTTG TTAATTTTCT ACTCATCTTT ACTAGTATAA ATTATGCCAC TAATTAAGTT CCTAGAGTTA
CTTTTCATGT TCAGAAGTTG CATGCATGCA TGGCAAGTTA CTTTAATTAC TGTGCTCTTG TTTAAAGAAA AGTGTTAACT
TTATTCTAAA AAAAAAGTGT TAACTTTACA GTTACACAGA TATGTCCCTC ATTAGAAGGT GTAATAAATC TGTTTGTTTG
CAGACATGAT GGCCAGTAAC TTTTGCAGCA TCACGCCTAC TACAAGCGCA AGAAAAGCTA GCTACTACTG GAACAAGGGA
TCTTAATCAT GTTTTGAAAC TTAATTAGTA ATATTTTAAA AAATCGTACT ATACTAATCA TGATGTGTAG CGTATTGCAC
CACTGAATTT ATTACTGTAA TTAACATGGT GAGTGTTAAA ATATTTTGTG ATATC