Os04t0341500-01

Locus

Os04g0341500

Description

Similar to OSIGBa0159H11-OSIGBa0137A07.8 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTPS20, TPS20

Oryzabase Gene Name Synonym(s)

terpene synthase 20

Transcript Evidence

AK289110 (DDBJ, Best hit)

Protein Evidence

Q01HV1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: magnesium ion binding (GO:0000287)

Molecular Function: lyase activity (GO:0016829)

Functional domain (InterPro)

Terpene synthase, metal-binding domain (IPR005630)

Terpenoid synthase (IPR008949)

Full-length cDNA

J090096N10 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0341500-01)

Others

Oryzabase (18716)

KEGG (Os04t0341500-01)

Transcript

4891 bp

>Os04t0341500-01 Similar to OSIGBa0159H11-OSIGBa0137A07.8 protein.
ATAAATCAATTAATACTCATTGCTTCTAATGATCTAATATATATATCTTAAATATACTTC
AAAACAAGCACCTAAAACAATCGATcattttaattttcaggtggtggaaagatctttatg
gatatgtcgagctaagtcatgttagagatcgtgcagtggagtcatatctttggtcctatg
cgctattctatgaagaaaacttaacactcacacggatgatccttgccaagataattgtat
tcattgtccttatggatgacacatatgatgatcatgccaccatcgaggaatgcaggaagc
tgaatgaagccatacaaaggtacgattaattAATAGGTCAAAAACAACAGAAATTAATAT
CCTTCATCTCAAGCCACCAATTGTAAGAGAAATCAAGAAAACCGCACAACAAATTATATT
TAAAAGTTCTAAAGTTTCACAGAATATTATAATATGTTAAAGATCAGGCTTTTCAAAATT
GAAAGGTACAGATGATCAAATCAGAAGCCCAAAAATAAATCAAAATTTAACTATTCTACC
CCTATACCTGTAAATCTGAATCAATTAAAACCTCTAACCGCTATGCATGACCGTGTGATA
TAACCTCATATACTTAAAGTAATTTCTATGGAAAAATATACAGAGATAGATAGAAAGAGG
GAGAGAGAGAGAACGTGCTATTGCGTAACACGTAGCATGTTGTTTAACTAAGCAATGTGT
CACACGCGTGCCCATCGATCCTCTGCACCTCTCCCACCCCTTCATTAGCTACCCTCTGCC
CCTCCCATGCAGATTCAATATTTTGTGTATTTTTGGAAGACCCTACCTATACTTTTACTT
CTAGATGGGATGGGGAGGGGATAGATTGGGATGGTTGTCTCTGACGCATTGTCTAGATGG
CCAAAAGCTGGCAGTCTTTTTATTTCAATAATAGGCACATGCACATTTTTCATCGTAACC
ACTACAAACCATTTCCGTGTCCCTATGAAGATGACTAATGCCGCCCAGGGTCATATAACA
AAAGAAAACTATTTCTACAGATAGCTCCTTATGAAAAATTGCATGTGAAAATAGGTCTAT
TAACACAAATGGGTCGCGTAATTTGAAAGGTGGGGTCATTTTTATATACGGATCTTATAA
GAAAAAATCAATAAAATTGATTTTTAAGGGCAGTTCTATTAGGAAACCACTTGTAACTCT
TTCCTATGATGTCGCCTAATGACAAATGTTATGTGACAATTGTAGTTCTTGTTGAGATGT
TGTAGTTAATGTTTTTCTATTTTAGGTAGTTAATGGGATCAAAAGTTCATTATAAGAAGC
TTTAAGGTCTACATTAGAATTTTTTGTTACATACGTTGACGGGtacaatttctataaaac
aatatagcgctcgacaaggtttgtaactttctagtcaaagttatttcatttaagaacact
taggtgccgaaatattcgtttcaaattcggaatctactttttaaaaaaggatgattttac
aaacagatctttatgaagtctaaagttttaaaattcatagaAAATACACCTTAAGTCCAA
TTGAGTTAATCCAAAGTTCTATGAGATCCTTACAATATTTCCTCAAATATGGCCTAGTCA
ATTTTTTTTTATATTTCCTTTATTATGAACATTCACAAATGTCAAGTTGCATAACACATC
AAAACATACAGTGGGAACTTGACATAAGTGAACAATGATATTACCAAAATATGGACCTTA
CAAATTTAATGAAAAAATTGTTGGGATCATATATAACTTTAGTTCACCTCAATCGCACTT
CAAATGAACACTACATAAATCTTTAAGGTTTTAATATGTGTTACAAGTTTAAGAGAGTTT
AAATTAGAAGATCAACGTCTATTTCATAGTAATTAACAAAGTGCTTCATATGTAAGATGG
TAATAAGTAAGATACACGTGAAGGGAGAGATCCCGGATTTGAATCCTACATACTAGATGC
ATATTTTGTGTGAAAAAATTGCGAACTTGTGACAATTAAAATATGAAATACTTTTTGCGC
CTACAATAATTAAAGACTTGAAAGTCGAACTTAAAATACAAAAAAATAGATTTGTTAACA
TGCAGTTGTGCAATCCACTAGCACAAAACTGTCGATTTCTATAGGCCCTATGTAACATTT
GGTTGGCTAAACACTTCCAAAAATGGGGGTACCAATTATATTGTAACTGCCTATAAAAGT
AGTTTTCCGAGCATTCAACATTCCACCTCTAATTCTAGAGCAGCAAAACATGCGAGTTTT
TCCAACTACTATGCAATGACCAAGCAGAGTACCGCTCATGCATACACATATATTCTACTG
TCATTCTATCAAGAAACAGCTAAGGCCAACTTTTAGTTAATTAAAACAGAGATGTGCAAC
TGGAGGTAGAGCTAGCTACAACTACCAAAGGTAGCTGGCATCAGTATTCTTGTTACCGAG
CTGTTGCTGCCAGCATGATATGAACCAACAATTTCCATGAACCCGAGCTACTTAGAGCAA
ATAAAAAAGAAATTGTTTATTTTACCTTTTGATGTTTAATGCACCTAAACAATTAATCTG
AGTAAAGCACAACTGAAAAACCATGTTGATCCTCTAACTAAATAAATTTGTTGTACAGTT
ACCATCGAATTTATCGATCACTATACATCTCAATTAATTATGGTCACGCGTTTCACACAA
TGTTAACAAGTCTTTCATTCGAGAAATATTAAACATCATCAAACCACTTTATTCGTCACT
GGTACATGGCGTGTCCATTTGAGCATAATTTACAAAGTATTTCATTCATTTATTTGTGGT
TTCAACGCGATACATCCCTGTCAAACTATCTTTTTCGGCTAGATTTATTTACACTTGCCT
AATTAAGTAATTTCATAAAAATTCCCAATTGGCCTATTGGACAGATGGGATGAAAGTGCT
ATCTCATTACTACCAGAGTACATGAAAAAGTTCTACCGTGCACTGCAGAATTACTTCAGG
GAGACTGAAGCTCAAGTAGAGGCCAGTGACAAATACCGGGTGACCTGCATGAAAAAAGAG
GTATACCAGTTATATATGTACTGCATCTTTCCACTTTTATTTCCTGTATTTGTTTAAATC
TTCATATTATGCATTGATCGTTAATGGATTCTTCTTACTGTATGTTATCGATATATACCA
AGAAAAGATCGTGTGCACCAATGAAATTTGTCATCTATTGGAATAAACTATCCACATTTA
TTATATATTCAATATAAGAGCATCACCAACAGTTCCCAAAATTCTATCCCCGAAATCTTT
TGTTTAAATCACTAATGAGAAAATTTTGGGATAGAATCTAGGGCTAACTTTTCACCACCA
AACCTAAAATTTTGAAACCATATTGAACATCTATTACTGATAGAAAATCGTAATAATCCA
GGTACCAATACTTATAGCTGTATGCTCAACATGAATTTGTTAAACCATGCCTAAACGATA
ACACACGTGCTTTTTCATCCTCACTTTATGTAAAATGTTTAGTAAGTGTTGCTAGAACTT
GGACAACTAGATACGTAAACTTGTGTAACCCTCCCAAAATTAGCATGGTAGGACTAAACT
TCTCATTTCATACTGTACACACGTAGACTTCTATGcactacgagacttgtgccaacccta
cggatcaaaaattgtcagaaaaatagggtttatccatagaaattgtatttttgagggaac
cgacaagaattgccgatagaaaaatcacaacggagaaattagattttcctatgggtttcc
ctatgtgtttaacacagaaaaattccattggcatcgggttttgtcgcctaaattgtgacg
tgctgccgtcaggaaaaAAGATCATGTGGCACCATAAAATAAAATGGCTCCAAGACAACC
TCCCGCCCCCCCCCCCAACAATTCAATCCACATATCCATATGGATTATTGAACATAACTT
TTTCAACAAAATATGCAAATGAACTCTTTTTTTTTTACTGATACATAAGTGATAAAGCTA
CAGATAGGCATGCACAACAATTCAGCATCAAATTTTAAGCAAACTTCAATCCTGTAAGTT
ATATAACCAATACACGTACATGCCAATTCACATCAACAAGAATCTTTTATTCACCACTAT
AAGTTACAAGTTATGGTACTACATGTCCTCCGGCAGCAATATTCCAAGCTAGATGAGACA
ATGAATGCAGATATCTTATCCCTTTTCAATGCATTTTTATCTCTATCTATTTTCTCCTCT
TTACTTGCCTTGAGAATACTACAGATTATGGTAAAAATATATCAAGGTATAGGAGACACA
CAATATTGTAAGCTGATCAATAAGATCCTGCTATATGCTTAAAAAGTTGTGGTTCATGAG
GATACTACAAACAGCATAATATTGAATACATGTAAGTAACTGTCAGTCTAACAATTCCAA
GGATATAAATAACTGATTAATCATATGGCTGCTATTATCATGCTTTAATGTTCTATACTA
TTTATGAAATTCATATATTATTTAGCCCAATAGCTTAAATGGAATTATCTGCCATATCAA
TCTAGCTAGCAGGAAGCACAATTAACCCATAGCTTATACTTAATCTAATCGTATTCCAGC
GGGCTTTGCACAAAATATATATCCTTCACTGACACACGAACTACATATCCTTAACAAGAT
GGACAGGGACTGAAGATACACGCAAAATAATGAACTAGCTAGAGACTTTAAGTGCATACA
TCGATCTAAATATGTTGTTTTTTAATCATAACAATATTAGAAGAAACCAAGGGAAGGCCA
TGGCTTTTTTCTACAATAGGAAACTATGAAGTCACAACCTCTCAGCATTCAAGCACCTTA
CTTAATACAGTAGACAAAAATCATTCGAAAG

CDS

297 bp

>Os04t0341500-01 Similar to OSIGBa0159H11-OSIGBa0137A07.8 protein.
TCTAATATATATATCTTAAATATACTTCAAAACAAGCACCTAAAACAATCGATcatttta
attttcaggtggtggaaagatctttatggatatgtcgagctaagtcatgttagagatcgt
gcagtggagtcatatctttggtcctatgcgctattctatgaagaaaacttaacactcaca
cggatgatccttgccaagataattgtattcattgtccttatggatgacacatatgatgat
catgccaccatcgaggaatgcaggaagctgaatgaagccatacaaaggtacgattaa

Protein

99 aa

>Os04t0341500-01 Similar to OSIGBa0159H11-OSIGBa0137A07.8 protein.
SNIYILNILQNKHLKQSIILIFRWWKDLYGYVELSHVRDRAVESYLWSYALFYEENLTLT
RMILAKIIVFIVLMDDTYDDHATIEECRKLNEAIQRYD*

5'UTR

chr04:16158051..16158082 (- strand) : 32 bp

CDS

chr04:16157754..16158050 (- strand) : 297 bp

3'UTR

chr04:16153192..16157753 (- strand) : 4562 bp

FASTA

>Os04t0341500-01 class=Sequence position=chr04:16153192..16158082 (- strand)
ATAAATCAAT TAATACTCAT TGCTTCTAAT GATCTAATAT ATATATCTTA AATATACTTC AAAACAAGCA CCTAAAACAA
TCGATcattt taattttcag gtggtggaaa gatctttatg gatatgtcga gctaagtcat gttagagatc gtgcagtgga
gtcatatctt tggtcctatg cgctattcta tgaagaaaac ttaacactca cacggatgat ccttgccaag ataattgtat
tcattgtcct tatggatgac acatatgatg atcatgccac catcgaggaa tgcaggaagc tgaatgaagc catacaaagg
tacgattaat tAATAGGTCA AAAACAACAG AAATTAATAT CCTTCATCTC AAGCCACCAA TTGTAAGAGA AATCAAGAAA
ACCGCACAAC AAATTATATT TAAAAGTTCT AAAGTTTCAC AGAATATTAT AATATGTTAA AGATCAGGCT TTTCAAAATT
GAAAGGTACA GATGATCAAA TCAGAAGCCC AAAAATAAAT CAAAATTTAA CTATTCTACC CCTATACCTG TAAATCTGAA
TCAATTAAAA CCTCTAACCG CTATGCATGA CCGTGTGATA TAACCTCATA TACTTAAAGT AATTTCTATG GAAAAATATA
CAGAGATAGA TAGAAAGAGG GAGAGAGAGA GAACGTGCTA TTGCGTAACA CGTAGCATGT TGTTTAACTA AGCAATGTGT
CACACGCGTG CCCATCGATC CTCTGCACCT CTCCCACCCC TTCATTAGCT ACCCTCTGCC CCTCCCATGC AGATTCAATA
TTTTGTGTAT TTTTGGAAGA CCCTACCTAT ACTTTTACTT CTAGATGGGA TGGGGAGGGG ATAGATTGGG ATGGTTGTCT
CTGACGCATT GTCTAGATGG CCAAAAGCTG GCAGTCTTTT TATTTCAATA ATAGGCACAT GCACATTTTT CATCGTAACC
ACTACAAACC ATTTCCGTGT CCCTATGAAG ATGACTAATG CCGCCCAGGG TCATATAACA AAAGAAAACT ATTTCTACAG
ATAGCTCCTT ATGAAAAATT GCATGTGAAA ATAGGTCTAT TAACACAAAT GGGTCGCGTA ATTTGAAAGG TGGGGTCATT
TTTATATACG GATCTTATAA GAAAAAATCA ATAAAATTGA TTTTTAAGGG CAGTTCTATT AGGAAACCAC TTGTAACTCT
TTCCTATGAT GTCGCCTAAT GACAAATGTT ATGTGACAAT TGTAGTTCTT GTTGAGATGT TGTAGTTAAT GTTTTTCTAT
TTTAGGTAGT TAATGGGATC AAAAGTTCAT TATAAGAAGC TTTAAGGTCT ACATTAGAAT TTTTTGTTAC ATACGTTGAC
GGGtacaatt tctataaaac aatatagcgc tcgacaaggt ttgtaacttt ctagtcaaag ttatttcatt taagaacact
taggtgccga aatattcgtt tcaaattcgg aatctacttt ttaaaaaagg atgattttac aaacagatct ttatgaagtc
taaagtttta aaattcatag aAAATACACC TTAAGTCCAA TTGAGTTAAT CCAAAGTTCT ATGAGATCCT TACAATATTT
CCTCAAATAT GGCCTAGTCA ATTTTTTTTT ATATTTCCTT TATTATGAAC ATTCACAAAT GTCAAGTTGC ATAACACATC
AAAACATACA GTGGGAACTT GACATAAGTG AACAATGATA TTACCAAAAT ATGGACCTTA CAAATTTAAT GAAAAAATTG
TTGGGATCAT ATATAACTTT AGTTCACCTC AATCGCACTT CAAATGAACA CTACATAAAT CTTTAAGGTT TTAATATGTG
TTACAAGTTT AAGAGAGTTT AAATTAGAAG ATCAACGTCT ATTTCATAGT AATTAACAAA GTGCTTCATA TGTAAGATGG
TAATAAGTAA GATACACGTG AAGGGAGAGA TCCCGGATTT GAATCCTACA TACTAGATGC ATATTTTGTG TGAAAAAATT
GCGAACTTGT GACAATTAAA ATATGAAATA CTTTTTGCGC CTACAATAAT TAAAGACTTG AAAGTCGAAC TTAAAATACA
AAAAAATAGA TTTGTTAACA TGCAGTTGTG CAATCCACTA GCACAAAACT GTCGATTTCT ATAGGCCCTA TGTAACATTT
GGTTGGCTAA ACACTTCCAA AAATGGGGGT ACCAATTATA TTGTAACTGC CTATAAAAGT AGTTTTCCGA GCATTCAACA
TTCCACCTCT AATTCTAGAG CAGCAAAACA TGCGAGTTTT TCCAACTACT ATGCAATGAC CAAGCAGAGT ACCGCTCATG
CATACACATA TATTCTACTG TCATTCTATC AAGAAACAGC TAAGGCCAAC TTTTAGTTAA TTAAAACAGA GATGTGCAAC
TGGAGGTAGA GCTAGCTACA ACTACCAAAG GTAGCTGGCA TCAGTATTCT TGTTACCGAG CTGTTGCTGC CAGCATGATA
TGAACCAACA ATTTCCATGA ACCCGAGCTA CTTAGAGCAA ATAAAAAAGA AATTGTTTAT TTTACCTTTT GATGTTTAAT
GCACCTAAAC AATTAATCTG AGTAAAGCAC AACTGAAAAA CCATGTTGAT CCTCTAACTA AATAAATTTG TTGTACAGTT
ACCATCGAAT TTATCGATCA CTATACATCT CAATTAATTA TGGTCACGCG TTTCACACAA TGTTAACAAG TCTTTCATTC
GAGAAATATT AAACATCATC AAACCACTTT ATTCGTCACT GGTACATGGC GTGTCCATTT GAGCATAATT TACAAAGTAT
TTCATTCATT TATTTGTGGT TTCAACGCGA TACATCCCTG TCAAACTATC TTTTTCGGCT AGATTTATTT ACACTTGCCT
AATTAAGTAA TTTCATAAAA ATTCCCAATT GGCCTATTGG ACAGATGGGA TGAAAGTGCT ATCTCATTAC TACCAGAGTA
CATGAAAAAG TTCTACCGTG CACTGCAGAA TTACTTCAGG GAGACTGAAG CTCAAGTAGA GGCCAGTGAC AAATACCGGG
TGACCTGCAT GAAAAAAGAG GTATACCAGT TATATATGTA CTGCATCTTT CCACTTTTAT TTCCTGTATT TGTTTAAATC
TTCATATTAT GCATTGATCG TTAATGGATT CTTCTTACTG TATGTTATCG ATATATACCA AGAAAAGATC GTGTGCACCA
ATGAAATTTG TCATCTATTG GAATAAACTA TCCACATTTA TTATATATTC AATATAAGAG CATCACCAAC AGTTCCCAAA
ATTCTATCCC CGAAATCTTT TGTTTAAATC ACTAATGAGA AAATTTTGGG ATAGAATCTA GGGCTAACTT TTCACCACCA
AACCTAAAAT TTTGAAACCA TATTGAACAT CTATTACTGA TAGAAAATCG TAATAATCCA GGTACCAATA CTTATAGCTG
TATGCTCAAC ATGAATTTGT TAAACCATGC CTAAACGATA ACACACGTGC TTTTTCATCC TCACTTTATG TAAAATGTTT
AGTAAGTGTT GCTAGAACTT GGACAACTAG ATACGTAAAC TTGTGTAACC CTCCCAAAAT TAGCATGGTA GGACTAAACT
TCTCATTTCA TACTGTACAC ACGTAGACTT CTATGcacta cgagacttgt gccaacccta cggatcaaaa attgtcagaa
aaatagggtt tatccataga aattgtattt ttgagggaac cgacaagaat tgccgataga aaaatcacaa cggagaaatt
agattttcct atgggtttcc ctatgtgttt aacacagaaa aattccattg gcatcgggtt ttgtcgccta aattgtgacg
tgctgccgtc aggaaaaAAG ATCATGTGGC ACCATAAAAT AAAATGGCTC CAAGACAACC TCCCGCCCCC CCCCCCAACA
ATTCAATCCA CATATCCATA TGGATTATTG AACATAACTT TTTCAACAAA ATATGCAAAT GAACTCTTTT TTTTTTACTG
ATACATAAGT GATAAAGCTA CAGATAGGCA TGCACAACAA TTCAGCATCA AATTTTAAGC AAACTTCAAT CCTGTAAGTT
ATATAACCAA TACACGTACA TGCCAATTCA CATCAACAAG AATCTTTTAT TCACCACTAT AAGTTACAAG TTATGGTACT
ACATGTCCTC CGGCAGCAAT ATTCCAAGCT AGATGAGACA ATGAATGCAG ATATCTTATC CCTTTTCAAT GCATTTTTAT
CTCTATCTAT TTTCTCCTCT TTACTTGCCT TGAGAATACT ACAGATTATG GTAAAAATAT ATCAAGGTAT AGGAGACACA
CAATATTGTA AGCTGATCAA TAAGATCCTG CTATATGCTT AAAAAGTTGT GGTTCATGAG GATACTACAA ACAGCATAAT
ATTGAATACA TGTAAGTAAC TGTCAGTCTA ACAATTCCAA GGATATAAAT AACTGATTAA TCATATGGCT GCTATTATCA
TGCTTTAATG TTCTATACTA TTTATGAAAT TCATATATTA TTTAGCCCAA TAGCTTAAAT GGAATTATCT GCCATATCAA
TCTAGCTAGC AGGAAGCACA ATTAACCCAT AGCTTATACT TAATCTAATC GTATTCCAGC GGGCTTTGCA CAAAATATAT
ATCCTTCACT GACACACGAA CTACATATCC TTAACAAGAT GGACAGGGAC TGAAGATACA CGCAAAATAA TGAACTAGCT
AGAGACTTTA AGTGCATACA TCGATCTAAA TATGTTGTTT TTTAATCATA ACAATATTAG AAGAAACCAA GGGAAGGCCA
TGGCTTTTTT CTACAATAGG AAACTATGAA GTCACAACCT CTCAGCATTC AAGCACCTTA CTTAATACAG TAGACAAAAA
TCATTCGAAA G

Locus: Os04g0341500

Loading...

Locus: Os04g0341500

Loading...