Os04t0390600-01

Locus

Os04g0390600

Description

Oligopeptide transporter OPT superfamily protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YSL5

CGSNL Gene Name

YELLOW STRIP-LIKE GENE 5

Oryzabase Gene Symbol Synonym(s)

OsYSL5, OsYs9

Oryzabase Gene Name Synonym(s)

rice YSL (yellow stripe-like) gene 5, Probable metal-nicotianamine transporter YSL5, Protein YELLOW STRIPE LIKE 5, yellow stripe 1-like transporter 5

Transcript Evidence

AK108750 (DDBJ, Best hit)

Protein Evidence

Q01LD4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

002-150-F05 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0390600-01)

RiceXPro (AK108750)

Others

Oryzabase (8363)

KEGG (Os04t0390600-01)

Transcript

1428 bp

>Os04t0390600-01 Oligopeptide transporter OPT superfamily protein.
GTTTTATTTCAACTTTAATCCTAGTTATGTTGGGTATGGTCTTATTTCCCCCCATATTGT
CAACTGCTCAGTTTTTCTTGGGTCAGTCATATCTTGGGGTTTTCTTTGGCCATTTATCGC
TAAGCAAGCTGGTGATTGGTACCCAGATAACCTTAGTAACACTGACTTCAGAGGCCTATA
TGGGTACAAGGTTTTCATAGCAATTTCTGTCATACTTGGTGATGGCCTCTACAACTTGGT
AAAAGTATTCCTTATTATTGCAAAGGAAATATGTAATGCACGATCAAAAGAACATGACCT
ACCTGTTCAAGCTCTACTTCAAGATGATGACAGTTCCAGACAATTATTGGACGAGAAACG
TCAAACTGAGATATTCCTTAAAGACAGCATACCTACTTGGCTTGCTGTTTCTGGTTACAT
TGTTCTTGCAGCAATATCTACCGTGGCTGTACCCATCATATTTCCCCAActgaagtggta
ccttgtccttgtctgctacttccttgctcctgccattgccttctgcaactcttacgggat
gggcctcacaaacttgaaccttgcacccacatatggcaagattgccctcttcgtgtttgc
ctcgcttgttggcagtgatggtggtgtcattgctggccttgcagcatgtggtgtaatcat
gtcaatcgtctgctccacagcggatctcatgcaggacttcaagagcggctatctcaccct
ctcctcgcCTCGATCGATGTTCATTTCCCAGATGATCGGTGTCGCCCTCGGGTGCATAAT
CGCTCCACTCACACTCTGGCTCTTCTGGACAGCGTTTGACATCGGTGACCCTGACGGCGA
GTACAAGGCCCCATTTGCCATCATCTTCAGGGAGATGGCCATCATCGGCATCGAAGGCTT
TGCGGCGCTGCCAAGGCACTGCCTTGAGATCTGCTGTGTGTTCTTCTTGGCAGCACTGAT
CATCAACCTCATGAAGGATGTTGTACCAAACCATGTCTCCAGGTTCATCCCCATTCCGAT
GGCGATGGCCGTGCCATTCTACATTGGCGCGTATTTCGGCGTGGACATGTTCATAGGGAC
ATTGATCCTGTTCGCCTGGCAGAAGATAGACCGGAGAGAGGCTGATGACTATGCGGTGGC
AGTTGCGTCCGGCTTGATCTGTGGAGATGGGGTCTGGAGCATTCCTTCTGCTGTTCTGTC
CATCCTGGGAGTTGATCCACCGATCTGCATGTCCTTCAGGCCATCTTCAGCTTCTGTATG
AGACGATGGATCAAAACTTTGGAGTTTTCATGCGGTTATATGATTGAAGCTGAGCCTCTG
TAAATGCATTCATACAAAGTAGATTTGTGTTGTGTATATTTTCTACTTCTGTGTACAATT
GTGTAGAAAATGGGACATTGGAATTTAGAGCCGTTGTCCACGATGAAC

CDS

1260 bp

>Os04t0390600-01 Oligopeptide transporter OPT superfamily protein.
TTTTATTTCAACTTTAATCCTAGTTATGTTGGGTATGGTCTTATTTCCCCCCATATTGTC
AACTGCTCAGTTTTTCTTGGGTCAGTCATATCTTGGGGTTTTCTTTGGCCATTTATCGCT
AAGCAAGCTGGTGATTGGTACCCAGATAACCTTAGTAACACTGACTTCAGAGGCCTATAT
GGGTACAAGGTTTTCATAGCAATTTCTGTCATACTTGGTGATGGCCTCTACAACTTGGTA
AAAGTATTCCTTATTATTGCAAAGGAAATATGTAATGCACGATCAAAAGAACATGACCTA
CCTGTTCAAGCTCTACTTCAAGATGATGACAGTTCCAGACAATTATTGGACGAGAAACGT
CAAACTGAGATATTCCTTAAAGACAGCATACCTACTTGGCTTGCTGTTTCTGGTTACATT
GTTCTTGCAGCAATATCTACCGTGGCTGTACCCATCATATTTCCCCAActgaagtggtac
cttgtccttgtctgctacttccttgctcctgccattgccttctgcaactcttacgggatg
ggcctcacaaacttgaaccttgcacccacatatggcaagattgccctcttcgtgtttgcc
tcgcttgttggcagtgatggtggtgtcattgctggccttgcagcatgtggtgtaatcatg
tcaatcgtctgctccacagcggatctcatgcaggacttcaagagcggctatctcaccctc
tcctcgcCTCGATCGATGTTCATTTCCCAGATGATCGGTGTCGCCCTCGGGTGCATAATC
GCTCCACTCACACTCTGGCTCTTCTGGACAGCGTTTGACATCGGTGACCCTGACGGCGAG
TACAAGGCCCCATTTGCCATCATCTTCAGGGAGATGGCCATCATCGGCATCGAAGGCTTT
GCGGCGCTGCCAAGGCACTGCCTTGAGATCTGCTGTGTGTTCTTCTTGGCAGCACTGATC
ATCAACCTCATGAAGGATGTTGTACCAAACCATGTCTCCAGGTTCATCCCCATTCCGATG
GCGATGGCCGTGCCATTCTACATTGGCGCGTATTTCGGCGTGGACATGTTCATAGGGACA
TTGATCCTGTTCGCCTGGCAGAAGATAGACCGGAGAGAGGCTGATGACTATGCGGTGGCA
GTTGCGTCCGGCTTGATCTGTGGAGATGGGGTCTGGAGCATTCCTTCTGCTGTTCTGTCC
ATCCTGGGAGTTGATCCACCGATCTGCATGTCCTTCAGGCCATCTTCAGCTTCTGTATGA

Protein

420 aa

>Os04t0390600-01 Oligopeptide transporter OPT superfamily protein.
FYFNFNPSYVGYGLISPHIVNCSVFLGSVISWGFLWPFIAKQAGDWYPDNLSNTDFRGLY
GYKVFIAISVILGDGLYNLVKVFLIIAKEICNARSKEHDLPVQALLQDDDSSRQLLDEKR
QTEIFLKDSIPTWLAVSGYIVLAAISTVAVPIIFPQLKWYLVLVCYFLAPAIAFCNSYGM
GLTNLNLAPTYGKIALFVFASLVGSDGGVIAGLAACGVIMSIVCSTADLMQDFKSGYLTL
SSPRSMFISQMIGVALGCIIAPLTLWLFWTAFDIGDPDGEYKAPFAIIFREMAIIGIEGF
AALPRHCLEICCVFFLAALIINLMKDVVPNHVSRFIPIPMAMAVPFYIGAYFGVDMFIGT
LILFAWQKIDRREADDYAVAVASGLICGDGVWSIPSAVLSILGVDPPICMSFRPSSASV*

5'UTR

chr04:19229851..19229851 (+ strand) : 1 bp

CDS

chr04:19229852..19230040 (+ strand) : 189 bp

chr04:19230316..19230448 (+ strand) : 133 bp

chr04:19230646..19231583 (+ strand) : 938 bp

3'UTR

chr04:19231584..19231750 (+ strand) : 167 bp

FASTA

>Os04t0390600-01 class=Sequence position=chr04:19229851..19231750 (+ strand)
GTTTTATTTC AACTTTAATC CTAGTTATGT TGGGTATGGT CTTATTTCCC CCCATATTGT CAACTGCTCA GTTTTTCTTG
GGTCAGTCAT ATCTTGGGGT TTTCTTTGGC CATTTATCGC TAAGCAAGCT GGTGATTGGT ACCCAGATAA CCTTAGTAAC
ACTGACTTCA GAGGCCTATA TGGGTACAAG GTACATATAT TTATCCTCGT ATCCATTAAA TTGATGATGG TCCTCGCTGG
GTCCAATTTT GAGCAACTAT TTTTGAAATT TAAAAATCTT TCATTGGACC TCTTTGAAGA GATTCTCTTG GCAACCAACA
TTCCTACTGT TAGTACTCAG TACCACTGAA GTAATATGGT CTCAGGGAAT TTGTTTTTCT TTAATATATT TAACAATTTT
GTAAAATAAA ATTTTATGTA AATGATAATG CATGATCTTC TCATAATTGT ATTATATCCC CACAGGTTTT CATAGCAATT
TCTGTCATAC TTGGTGATGG CCTCTACAAC TTGGTAAAAG TATTCCTTAT TATTGCAAAG GAAATATGTA ATGCACGATC
AAAAGAACAT GACCTACCTG TTCAAGCTCT ACTTCAAGGT AGCATGAATA GCTCATGACA TTTTTGGCCT ATGTTTATCT
GTTCTACAAT ATCTTGGCAT TTTTCTTCAC TAATTCAGAC TAATTCTTGG AGTTTTACTG TTTTTGGCTT TAACTATGCA
CTTATTTGCT TGCAGAATAT CATCTCTCAT TTGTCCTAAT TTTGAGCACT GAAAATGTTT GTTGGTATTT TTCAGATGAT
GACAGTTCCA GACAATTATT GGACGAGAAA CGTCAAACTG AGATATTCCT TAAAGACAGC ATACCTACTT GGCTTGCTGT
TTCTGGTTAC ATTGTTCTTG CAGCAATATC TACCGTGGCT GTACCCATCA TATTTCCCCA Actgaagtgg taccttgtcc
ttgtctgcta cttccttgct cctgccattg ccttctgcaa ctcttacggg atgggcctca caaacttgaa ccttgcaccc
acatatggca agattgccct cttcgtgttt gcctcgcttg ttggcagtga tggtggtgtc attgctggcc ttgcagcatg
tggtgtaatc atgtcaatcg tctgctccac agcggatctc atgcaggact tcaagagcgg ctatctcacc ctctcctcgc
CTCGATCGAT GTTCATTTCC CAGATGATCG GTGTCGCCCT CGGGTGCATA ATCGCTCCAC TCACACTCTG GCTCTTCTGG
ACAGCGTTTG ACATCGGTGA CCCTGACGGC GAGTACAAGG CCCCATTTGC CATCATCTTC AGGGAGATGG CCATCATCGG
CATCGAAGGC TTTGCGGCGC TGCCAAGGCA CTGCCTTGAG ATCTGCTGTG TGTTCTTCTT GGCAGCACTG ATCATCAACC
TCATGAAGGA TGTTGTACCA AACCATGTCT CCAGGTTCAT CCCCATTCCG ATGGCGATGG CCGTGCCATT CTACATTGGC
GCGTATTTCG GCGTGGACAT GTTCATAGGG ACATTGATCC TGTTCGCCTG GCAGAAGATA GACCGGAGAG AGGCTGATGA
CTATGCGGTG GCAGTTGCGT CCGGCTTGAT CTGTGGAGAT GGGGTCTGGA GCATTCCTTC TGCTGTTCTG TCCATCCTGG
GAGTTGATCC ACCGATCTGC ATGTCCTTCA GGCCATCTTC AGCTTCTGTA TGAGACGATG GATCAAAACT TTGGAGTTTT
CATGCGGTTA TATGATTGAA GCTGAGCCTC TGTAAATGCA TTCATACAAA GTAGATTTGT GTTGTGTATA TTTTCTACTT
CTGTGTACAA TTGTGTAGAA AATGGGACAT TGGAATTTAG AGCCGTTGTC CACGATGAAC