Os04t0391500-01

Locus

Os04g0391500

Description

Similar to ACR4.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ACR6

CGSNL Gene Name

ACT DOMAIN REPEAT PROTEIN 6

Oryzabase Gene Symbol Synonym(s)

OsACR6

Oryzabase Gene Name Synonym(s)

ACT-domain repeat protein 6

Transcript Evidence

AK067296 (DDBJ, Best hit)

Protein Evidence

Q01LC6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Molecular Function: amino acid binding (GO:0016597)

Functional domain (InterPro)

Amino acid-binding ACT (IPR002912)

Full-length cDNA

J013102O07 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0391500-01)

RiceXPro (AK067296)

Others

Oryzabase (7256)

KEGG (Os04t0391500-01)

Transcript

1930 bp

>Os04t0391500-01 Similar to ACR4.
GGGAGAAGAGTCGTGGCTTCCTCGCACAGATAAAAAGGCGAGGAGGCATTTCCCCGGTTT
CCTCTCTGTCCGGGTCCAGGCCAGCACGAACTACGCCCACAACGAACTTTTAGCTGTGTT
TAGCTTAAGCCACCCACCACTCGCACTCGCGTACGTACTCGTCGCATGTGAGTTAGCTTT
GGTCGCCGGCATGGCGCTCACGGCGGCGGCGGCGAGCGGCGGCGACGCGCACGACGACGA
GTACGCGAAGCTGGTGCGGGGGATGAACCCGCCGAGGGTGGTGGTGGACAACGAGGCGTG
CGACGAGGCGACGGTGATCCGGGTCGACAGCGTCAGCAGCCACGGCACGCTGCTCGCCGT
CGTCCAGGTCATCGCCGACCTCGGCCTCGTCATCCGCAAGGCCTACTTCTCCTCCGACGG
CAGCTGGTTCATGGACGTGTTCAACGTCACCGACCGCGACGGCAACAAGGTGCTCGATGA
CCAAACCATCTCCTACATCCAAACGACGCTGGAGGCGGATGACTGGTACTACCCGGAGGT
GAGGAACACGGTGGGGATCGTGCCGGCGGAGGAGTACACGGTGATCGAGCTCACCGGCAC
CGACCGACCGGGGCTCCTCTCCGAGGTgtgcgcggtgctcgccggcatgcgctgcgccgt
gcggagcgccgagctgtggacgcacaacacccgcgtcgccgccgtcgtgcacgtcaccga
cgacgGCGGCTCCGGCGGCGCCATCGAGGACGAGGCCCGCATCGCCGACATCAGCACCCG
CCTCGGGAACCTCCTCCGCGGACAGAGCGGCGTGCGCGCCGCCGCCGCCGCCGCTCCGGG
CGGGCTCACCCACAAGGAGCGCCGCCTCCACCAGATGATGTTCGACGACCGCGACTACGA
CGGCGGCGGCGGCGCCGCCTCCTCCTCGCCGCGGGGGCGGTCCCCGACCCCGGCGACGGA
GGTGTCCGTGACGCCGTGCGCGGAGCGCGGGTACACCGCGGTGGTGGTGCGGTGCCGGGA
CCGGCCCAAGCTGCTGTTCGACACGGTGTGCACCATCACCGACATGGGGTACGTCATCCA
CCACGGCGCGGTGAGCAGCGAGCCCCGCGGCGGCGCGTACCAGGAGTACTACATCCGGCA
CGTCGACGGCGACCCCGTCCGCTCCGAGGCGGAGCGGCAGCGCGTGGTGCAGTGCCTCGA
GGCCGCCATCGAGCGCCGCACCGCCGACGGGCTGGCGCTGGAGGTCCGCACCGGCGACCG
CGCCGGCCTCCTCTCCGACGTCACCCGCATCTTCCGCGAGAACGGCCTCACCATCCGCCG
CGCCGAGATCTCGTCGGAGCGCGGCGAGGCCGTGGACACGTTCTACCTCTCCGACCCGCA
GGGCCACCCCGTGGAGGCCAAGACGATCGACGCCATCCGCGCGCAGATCGGCGAGGCCAC
GCTGCGTGTCAAGCACAACCCCTTCGCCGACGGCGATGGCGCCGGCGGCGGCGGCGGCGG
CGCCACCGATGACGTCGCTGGCTCGACGGCGTTCCTCTTCGGGAATCTCTTCAAATTCTA
CCGGCCGTTCCAGAACTTCAGCCTCATCAAGCTCTACTCCTAATTAATTTACTCCAACCT
GGGTTAATTAATTAGCTGTAAATAATTACTTAGTTAGTTAGTTTTATGTTTTTTTCTTCT
AGATTTTACTGTAAATATGATTTCAGATTTATGACGACGACGAAGATGATGTAGGCTGGG
TGGTGTAAATAGGTTTACACATGGTACAAAACATAGGGGGAAAGTTAATTCAAAATTTAG
GTCAGGGAAAAAAAATCATGTAGGATTAGTTTCATCAGTATACTGGCATTGGGGGTATAC
AGTCGCTGTAAATATTCCATCTTGTACATGTATTCATGGAAGGAATACAAAGAATGAAAC
AAAAGCTTGT

CDS

1413 bp

>Os04t0391500-01 Similar to ACR4.
ATGGCGCTCACGGCGGCGGCGGCGAGCGGCGGCGACGCGCACGACGACGAGTACGCGAAG
CTGGTGCGGGGGATGAACCCGCCGAGGGTGGTGGTGGACAACGAGGCGTGCGACGAGGCG
ACGGTGATCCGGGTCGACAGCGTCAGCAGCCACGGCACGCTGCTCGCCGTCGTCCAGGTC
ATCGCCGACCTCGGCCTCGTCATCCGCAAGGCCTACTTCTCCTCCGACGGCAGCTGGTTC
ATGGACGTGTTCAACGTCACCGACCGCGACGGCAACAAGGTGCTCGATGACCAAACCATC
TCCTACATCCAAACGACGCTGGAGGCGGATGACTGGTACTACCCGGAGGTGAGGAACACG
GTGGGGATCGTGCCGGCGGAGGAGTACACGGTGATCGAGCTCACCGGCACCGACCGACCG
GGGCTCCTCTCCGAGGTgtgcgcggtgctcgccggcatgcgctgcgccgtgcggagcgcc
gagctgtggacgcacaacacccgcgtcgccgccgtcgtgcacgtcaccgacgacgGCGGC
TCCGGCGGCGCCATCGAGGACGAGGCCCGCATCGCCGACATCAGCACCCGCCTCGGGAAC
CTCCTCCGCGGACAGAGCGGCGTGCGCGCCGCCGCCGCCGCCGCTCCGGGCGGGCTCACC
CACAAGGAGCGCCGCCTCCACCAGATGATGTTCGACGACCGCGACTACGACGGCGGCGGC
GGCGCCGCCTCCTCCTCGCCGCGGGGGCGGTCCCCGACCCCGGCGACGGAGGTGTCCGTG
ACGCCGTGCGCGGAGCGCGGGTACACCGCGGTGGTGGTGCGGTGCCGGGACCGGCCCAAG
CTGCTGTTCGACACGGTGTGCACCATCACCGACATGGGGTACGTCATCCACCACGGCGCG
GTGAGCAGCGAGCCCCGCGGCGGCGCGTACCAGGAGTACTACATCCGGCACGTCGACGGC
GACCCCGTCCGCTCCGAGGCGGAGCGGCAGCGCGTGGTGCAGTGCCTCGAGGCCGCCATC
GAGCGCCGCACCGCCGACGGGCTGGCGCTGGAGGTCCGCACCGGCGACCGCGCCGGCCTC
CTCTCCGACGTCACCCGCATCTTCCGCGAGAACGGCCTCACCATCCGCCGCGCCGAGATC
TCGTCGGAGCGCGGCGAGGCCGTGGACACGTTCTACCTCTCCGACCCGCAGGGCCACCCC
GTGGAGGCCAAGACGATCGACGCCATCCGCGCGCAGATCGGCGAGGCCACGCTGCGTGTC
AAGCACAACCCCTTCGCCGACGGCGATGGCGCCGGCGGCGGCGGCGGCGGCGCCACCGAT
GACGTCGCTGGCTCGACGGCGTTCCTCTTCGGGAATCTCTTCAAATTCTACCGGCCGTTC
CAGAACTTCAGCCTCATCAAGCTCTACTCCTAA

Protein

471 aa

>Os04t0391500-01 Similar to ACR4.
MALTAAAASGGDAHDDEYAKLVRGMNPPRVVVDNEACDEATVIRVDSVSSHGTLLAVVQV
IADLGLVIRKAYFSSDGSWFMDVFNVTDRDGNKVLDDQTISYIQTTLEADDWYYPEVRNT
VGIVPAEEYTVIELTGTDRPGLLSEVCAVLAGMRCAVRSAELWTHNTRVAAVVHVTDDGG
SGGAIEDEARIADISTRLGNLLRGQSGVRAAAAAAPGGLTHKERRLHQMMFDDRDYDGGG
GAASSSPRGRSPTPATEVSVTPCAERGYTAVVVRCRDRPKLLFDTVCTITDMGYVIHHGA
VSSEPRGGAYQEYYIRHVDGDPVRSEAERQRVVQCLEAAIERRTADGLALEVRTGDRAGL
LSDVTRIFRENGLTIRRAEISSERGEAVDTFYLSDPQGHPVEAKTIDAIRAQIGEATLRV
KHNPFADGDGAGGGGGGATDDVAGSTAFLFGNLFKFYRPFQNFSLIKLYS*

5'UTR

chr04:19269218..19269407 (+ strand) : 190 bp

CDS

chr04:19269408..19269654 (+ strand) : 247 bp

chr04:19269727..19269794 (+ strand) : 68 bp

chr04:19269880..19270977 (+ strand) : 1098 bp

3'UTR

chr04:19270978..19271304 (+ strand) : 327 bp

FASTA

>Os04t0391500-01 class=Sequence position=chr04:19269218..19271304 (+ strand)
GGGAGAAGAG TCGTGGCTTC CTCGCACAGA TAAAAAGGCG AGGAGGCATT TCCCCGGTTT CCTCTCTGTC CGGGTCCAGG
CCAGCACGAA CTACGCCCAC AACGAACTTT TAGCTGTGTT TAGCTTAAGC CACCCACCAC TCGCACTCGC GTACGTACTC
GTCGCATGTG AGTTAGCTTT GGTCGCCGGC ATGGCGCTCA CGGCGGCGGC GGCGAGCGGC GGCGACGCGC ACGACGACGA
GTACGCGAAG CTGGTGCGGG GGATGAACCC GCCGAGGGTG GTGGTGGACA ACGAGGCGTG CGACGAGGCG ACGGTGATCC
GGGTCGACAG CGTCAGCAGC CACGGCACGC TGCTCGCCGT CGTCCAGGTC ATCGCCGACC TCGGCCTCGT CATCCGCAAG
GCCTACTTCT CCTCCGACGG CAGCTGGTTC ATGGACGGTC AGTCTCTCGC CGCCGTTTCT TGATTTGAGT TTCTACTAAA
TTCTAACCCT TGAAAGGAAA ATTCCGCAGT GTTCAACGTC ACCGACCGCG ACGGCAACAA GGTGCTCGAT GACCAAACCA
TCTCCTACAT CCAAACGGTA CTAGTGCTGT TCTTGATCGA AATTTGGGGA TTGAATTAAT TTGTTTGTTG ATTTGTGGTT
TGGTTGGTTG ATTGATTTTT AGACGCTGGA GGCGGATGAC TGGTACTACC CGGAGGTGAG GAACACGGTG GGGATCGTGC
CGGCGGAGGA GTACACGGTG ATCGAGCTCA CCGGCACCGA CCGACCGGGG CTCCTCTCCG AGGTgtgcgc ggtgctcgcc
ggcatgcgct gcgccgtgcg gagcgccgag ctgtggacgc acaacacccg cgtcgccgcc gtcgtgcacg tcaccgacga
cgGCGGCTCC GGCGGCGCCA TCGAGGACGA GGCCCGCATC GCCGACATCA GCACCCGCCT CGGGAACCTC CTCCGCGGAC
AGAGCGGCGT GCGCGCCGCC GCCGCCGCCG CTCCGGGCGG GCTCACCCAC AAGGAGCGCC GCCTCCACCA GATGATGTTC
GACGACCGCG ACTACGACGG CGGCGGCGGC GCCGCCTCCT CCTCGCCGCG GGGGCGGTCC CCGACCCCGG CGACGGAGGT
GTCCGTGACG CCGTGCGCGG AGCGCGGGTA CACCGCGGTG GTGGTGCGGT GCCGGGACCG GCCCAAGCTG CTGTTCGACA
CGGTGTGCAC CATCACCGAC ATGGGGTACG TCATCCACCA CGGCGCGGTG AGCAGCGAGC CCCGCGGCGG CGCGTACCAG
GAGTACTACA TCCGGCACGT CGACGGCGAC CCCGTCCGCT CCGAGGCGGA GCGGCAGCGC GTGGTGCAGT GCCTCGAGGC
CGCCATCGAG CGCCGCACCG CCGACGGGCT GGCGCTGGAG GTCCGCACCG GCGACCGCGC CGGCCTCCTC TCCGACGTCA
CCCGCATCTT CCGCGAGAAC GGCCTCACCA TCCGCCGCGC CGAGATCTCG TCGGAGCGCG GCGAGGCCGT GGACACGTTC
TACCTCTCCG ACCCGCAGGG CCACCCCGTG GAGGCCAAGA CGATCGACGC CATCCGCGCG CAGATCGGCG AGGCCACGCT
GCGTGTCAAG CACAACCCCT TCGCCGACGG CGATGGCGCC GGCGGCGGCG GCGGCGGCGC CACCGATGAC GTCGCTGGCT
CGACGGCGTT CCTCTTCGGG AATCTCTTCA AATTCTACCG GCCGTTCCAG AACTTCAGCC TCATCAAGCT CTACTCCTAA
TTAATTTACT CCAACCTGGG TTAATTAATT AGCTGTAAAT AATTACTTAG TTAGTTAGTT TTATGTTTTT TTCTTCTAGA
TTTTACTGTA AATATGATTT CAGATTTATG ACGACGACGA AGATGATGTA GGCTGGGTGG TGTAAATAGG TTTACACATG
GTACAAAACA TAGGGGGAAA GTTAATTCAA AATTTAGGTC AGGGAAAAAA AATCATGTAG GATTAGTTTC ATCAGTATAC
TGGCATTGGG GGTATACAGT CGCTGTAAAT ATTCCATCTT GTACATGTAT TCATGGAAGG AATACAAAGA ATGAAACAAA
AGCTTGT