Os04t0391500-02

Locus

Os04g0391500

Description

Similar to OSIGBa0145N07.1 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ACR6

CGSNL Gene Name

ACT DOMAIN REPEAT PROTEIN 6

Oryzabase Gene Symbol Synonym(s)

OsACR6

Oryzabase Gene Name Synonym(s)

ACT-domain repeat protein 6

Transcript Evidence

AK072197 (DDBJ, Best hit)

Protein Evidence

Q01LC6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Molecular Function: amino acid binding (GO:0016597)

Functional domain (InterPro)

Amino acid-binding ACT (IPR002912)

Full-length cDNA

J013160N15 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0391500-02)

RiceXPro (AK072197)

Others

Oryzabase (7256)

KEGG (Os04t0391500-02)

Transcript

1753 bp

>Os04t0391500-02 Similar to OSIGBa0145N07.1 protein.
GTCCGGGTCCAGGCCAGCACGAACTACGCCCACAACGAACTTTTAGCTGTGTTTAGCTTA
AGCCACCCACCACTCGCACTCGCGTACGTACTCGTCGCATGTGAGTTAGCTTTGGTCGCC
GGCATGGCGCTCACGGCGGCGGCGGCGAGCGGCGGCGACGCGCACGACGACGAGTACGCG
AAGCTGGTGCGGGGGATGAACCCGCCGAGGGTGGTGGTGGACAACGAGGCGTGCGACGAG
GCGACGGTGATCCGGGTCGACAGCGTCAGCAGCCACGGCACGCTGCTCGCCGTCGTCCAG
GTCATCGCCGACCTCGGCCTCGTCATCCGCAAGGCCTACTTCTCCTCCGACGGCAGCTGG
TTCATGGACGTGTTCAACGTCACCGACCGCGACGGCAACAAGGTGCTCGATGACCAAACC
ATCTCCTACATCCAAACGGTACTAGTGCTGTTCTTGATCGAAATTTGGGGATTGAATTAA
TTTGTTTGTTGATTTGTGGTTTGGTTGGTTGATTGATTTTTAGACGCTGGAGGCGGATGA
CTGGTACTACCCGGAGGTGAGGAACACGGTGGGGATCGTGCCGGCGGAGGAGTACACGGT
GATCGAGCTCACCGGCACCGACCGACCGGGGCTCCTCTCCGAGGTgtgcgcggtgctcgc
cggcatgcgctgcgccgtgcggagcgccgagctgtggacgcacaacacccgcgtcgccgc
cgtcgtgcacgtcaccgacgacgGCGGCTCCGGCGGCGCCATCGAGGACGAGGCCCGCAT
CGCCGACATCAGCACCCGCCTCGGGAACCTCCTCCGCGGACAGAGCGGCGTGCGCGCCGC
CGCCGCCGCCGCTCCGGGCGGGCTCACCCACAAGGAGCGCCGCCTCCACCAGATGATGTT
CGACGACCGCGACTACGACGGCGGCGGCGGCGCCGCCTCCTCCTCGCCGCGGGGGCGGTC
CCCGACCCCGGCGACGGAGGTGTCCGTGACGCCGTGCGCGGAGCGCGGGTACACCGCGGT
GGTGGTGCGGTGCCGGGACCGGCCCAAGCTGCTGTTCGACACGGTGTGCACCATCACCGA
CATGGGGTACGTCATCCACCACGGCGCGGTGAGCAGCGAGCCCCGCGGCGGCGCGTACCA
GGAGTACTACATCCGGCACGTCGACGGCGACCCCGTCCGCTCCGAGGCGGAGCGGCAGCG
CGTGGTGCAGTGCCTCGAGGCCGCCATCGAGCGCCGCACCGCCGACGGGCTGGCGCTGGA
GGTCCGCACCGGCGACCGCGCCGGCCTCCTCTCCGACGTCACCCGCATCTTCCGCGAGAA
CGGCCTCACCATCCGCCGCGCCGAGATCTCGTCGGAGCGCGGCGAGGCCGTGGACACGTT
CTACCTCTCCGACCCGCAGGGCCACCCCGTGGAGGCCAAGACGATCGACGCCATCCGCGC
GCAGATCGGCGAGGCCACGCTGCGTGTCAAGCACAACCCCTTCGCCGACGGCGATGGCGC
CGGCGGCGGCGGCGGCGGCGCCACCGATGACGTCGCTGGCTCGACGGCGTTCCTCTTCGG
GAATCTCTTCAAATTCTACCGGCCGTTCCAGAACTTCAGCCTCATCAAGCTCTACTCCTA
ATTAATTTACTCCAACCTGGGTTAATTAATTAGCTGTAAATAATTACTTAGTTAGTTAGT
TTTATGTTTTTTTCTTCTAGATTTTACTGTAAATATGATTTCAGATTTATGACGACGACG
AAGATGATGTAGG

CDS

357 bp

>Os04t0391500-02 Similar to OSIGBa0145N07.1 protein.
ATGGCGCTCACGGCGGCGGCGGCGAGCGGCGGCGACGCGCACGACGACGAGTACGCGAAG
CTGGTGCGGGGGATGAACCCGCCGAGGGTGGTGGTGGACAACGAGGCGTGCGACGAGGCG
ACGGTGATCCGGGTCGACAGCGTCAGCAGCCACGGCACGCTGCTCGCCGTCGTCCAGGTC
ATCGCCGACCTCGGCCTCGTCATCCGCAAGGCCTACTTCTCCTCCGACGGCAGCTGGTTC
ATGGACGTGTTCAACGTCACCGACCGCGACGGCAACAAGGTGCTCGATGACCAAACCATC
TCCTACATCCAAACGGTACTAGTGCTGTTCTTGATCGAAATTTGGGGATTGAATTAA

Protein

119 aa

>Os04t0391500-02 Similar to OSIGBa0145N07.1 protein.
MALTAAAASGGDAHDDEYAKLVRGMNPPRVVVDNEACDEATVIRVDSVSSHGTLLAVVQV
IADLGLVIRKAYFSSDGSWFMDVFNVTDRDGNKVLDDQTISYIQTVLVLFLIEIWGLN*

5'UTR

chr04:19269285..19269407 (+ strand) : 123 bp

CDS

chr04:19269408..19269654 (+ strand) : 247 bp

chr04:19269727..19269836 (+ strand) : 110 bp

3'UTR

chr04:19269837..19271109 (+ strand) : 1273 bp

FASTA

>Os04t0391500-02 class=Sequence position=chr04:19269285..19271109 (+ strand)
GTCCGGGTCC AGGCCAGCAC GAACTACGCC CACAACGAAC TTTTAGCTGT GTTTAGCTTA AGCCACCCAC CACTCGCACT
CGCGTACGTA CTCGTCGCAT GTGAGTTAGC TTTGGTCGCC GGCATGGCGC TCACGGCGGC GGCGGCGAGC GGCGGCGACG
CGCACGACGA CGAGTACGCG AAGCTGGTGC GGGGGATGAA CCCGCCGAGG GTGGTGGTGG ACAACGAGGC GTGCGACGAG
GCGACGGTGA TCCGGGTCGA CAGCGTCAGC AGCCACGGCA CGCTGCTCGC CGTCGTCCAG GTCATCGCCG ACCTCGGCCT
CGTCATCCGC AAGGCCTACT TCTCCTCCGA CGGCAGCTGG TTCATGGACG GTCAGTCTCT CGCCGCCGTT TCTTGATTTG
AGTTTCTACT AAATTCTAAC CCTTGAAAGG AAAATTCCGC AGTGTTCAAC GTCACCGACC GCGACGGCAA CAAGGTGCTC
GATGACCAAA CCATCTCCTA CATCCAAACG GTACTAGTGC TGTTCTTGAT CGAAATTTGG GGATTGAATT AATTTGTTTG
TTGATTTGTG GTTTGGTTGG TTGATTGATT TTTAGACGCT GGAGGCGGAT GACTGGTACT ACCCGGAGGT GAGGAACACG
GTGGGGATCG TGCCGGCGGA GGAGTACACG GTGATCGAGC TCACCGGCAC CGACCGACCG GGGCTCCTCT CCGAGGTgtg
cgcggtgctc gccggcatgc gctgcgccgt gcggagcgcc gagctgtgga cgcacaacac ccgcgtcgcc gccgtcgtgc
acgtcaccga cgacgGCGGC TCCGGCGGCG CCATCGAGGA CGAGGCCCGC ATCGCCGACA TCAGCACCCG CCTCGGGAAC
CTCCTCCGCG GACAGAGCGG CGTGCGCGCC GCCGCCGCCG CCGCTCCGGG CGGGCTCACC CACAAGGAGC GCCGCCTCCA
CCAGATGATG TTCGACGACC GCGACTACGA CGGCGGCGGC GGCGCCGCCT CCTCCTCGCC GCGGGGGCGG TCCCCGACCC
CGGCGACGGA GGTGTCCGTG ACGCCGTGCG CGGAGCGCGG GTACACCGCG GTGGTGGTGC GGTGCCGGGA CCGGCCCAAG
CTGCTGTTCG ACACGGTGTG CACCATCACC GACATGGGGT ACGTCATCCA CCACGGCGCG GTGAGCAGCG AGCCCCGCGG
CGGCGCGTAC CAGGAGTACT ACATCCGGCA CGTCGACGGC GACCCCGTCC GCTCCGAGGC GGAGCGGCAG CGCGTGGTGC
AGTGCCTCGA GGCCGCCATC GAGCGCCGCA CCGCCGACGG GCTGGCGCTG GAGGTCCGCA CCGGCGACCG CGCCGGCCTC
CTCTCCGACG TCACCCGCAT CTTCCGCGAG AACGGCCTCA CCATCCGCCG CGCCGAGATC TCGTCGGAGC GCGGCGAGGC
CGTGGACACG TTCTACCTCT CCGACCCGCA GGGCCACCCC GTGGAGGCCA AGACGATCGA CGCCATCCGC GCGCAGATCG
GCGAGGCCAC GCTGCGTGTC AAGCACAACC CCTTCGCCGA CGGCGATGGC GCCGGCGGCG GCGGCGGCGG CGCCACCGAT
GACGTCGCTG GCTCGACGGC GTTCCTCTTC GGGAATCTCT TCAAATTCTA CCGGCCGTTC CAGAACTTCA GCCTCATCAA
GCTCTACTCC TAATTAATTT ACTCCAACCT GGGTTAATTA ATTAGCTGTA AATAATTACT TAGTTAGTTA GTTTTATGTT
TTTTTCTTCT AGATTTTACT GTAAATATGA TTTCAGATTT ATGACGACGA CGAAGATGAT GTAGG